Align glycerol facilitator-aquaporin (characterized)
to candidate WP_017752629.1 PN53_RS13245 MIP/aquaporin family protein
Query= CharProtDB::CH_012828 (289 letters) >NCBI__GCF_000816635.1:WP_017752629.1 Length = 234 Score = 165 bits (417), Expect = 1e-45 Identities = 102/285 (35%), Positives = 146/285 (51%), Gaps = 57/285 (20%) Query: 8 KYITEFVGTALLIIMGNGAVANVELKGTKAHAQSWMIIGWGYGLGVMLPAVAFGNIT-SQ 66 K I EFVGT +L+ +G+G AN L +K WM+I G+ V +PA+ FG+++ + Sbjct: 3 KLIAEFVGTMILVYLGDGVCANCTLTKSKGQNGGWMVITAGWAFAVGIPALMFGSVSGAH 62 Query: 67 INPAFTLGLAASGLFPWAHVAQYIIAQVLGAMFGQLLIVMVYRPYYLKTQNPNAILGTFS 126 NPA T+GLAA+G FP A V YIIAQ+LG + G L+ + Y P++ KT++ A LG F Sbjct: 63 FNPALTIGLAAAGKFPAAEVPGYIIAQMLGGIVGGALVWITYLPHWEKTEDKAAKLGIFC 122 Query: 127 T---IDNVDDNSEKTRLGATINGFLNEFLGSFVLFFGAVAATNIFFGSQSITWMTNYLKG 183 T I N+ N FL EFLG+ +L F + G Sbjct: 123 TAPAIRNLPSN------------FLTEFLGTALLVFA--------------------ILG 150 Query: 184 QGADVSSSDVMNQIWVQASGASASKMIAHLFLGFLVMGLVVALGGPTGPGLNPARDFGPR 243 GA ++ I LF+ FL+ + ++LGGPTG +NPARD PR Sbjct: 151 MGAQHTALG-----------------IGTLFVVFLIWSIGLSLGGPTGYAINPARDLAPR 193 Query: 244 LVHSLLPKSVLGEAKGSSKWWYAWVPVLAPILASLAAVALFKMIY 288 + H++LP + KG S W Y+W+PV PI + LF +I+ Sbjct: 194 IAHAILPIA----GKGGSDWSYSWIPVFGPIAGGICGALLFNVIF 234 Lambda K H 0.323 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 289 Length of database: 234 Length adjustment: 24 Effective length of query: 265 Effective length of database: 210 Effective search space: 55650 Effective search space used: 55650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory