Align glycerol-3-phosphate oxidase; EC 1.1.3.21 (characterized)
to candidate WP_039651954.1 PN53_RS02695 NAD(P)/FAD-dependent oxidoreductase
Query= CharProtDB::CH_000554 (387 letters) >NCBI__GCF_000816635.1:WP_039651954.1 Length = 478 Score = 252 bits (644), Expect = 1e-71 Identities = 135/357 (37%), Positives = 222/357 (62%), Gaps = 5/357 (1%) Query: 7 DICIIGGGIIGASVARELAKFDKKIVVLEANPRLALETSSHNSGLVHGGFDPRPETLNAK 66 D+ IIG G+IG+ VAREL+++ I V+EA+ +A TS NS +VH GFD +P+TL K Sbjct: 3 DVTIIGSGVIGSIVARELSRYKLNICVIEADSDVANGTSKANSAIVHAGFDAKPDTLKGK 62 Query: 67 LNVLGKKRYEDWIKEMDFPYLRIDSTIVAFNDEEMKHVHMLYDRGLINGLDPKEMQVIDA 126 LN G K ++ +E+DFP+ RI S ++ F++ +M ++ L ++G NG+ ++++ Sbjct: 63 LNAKGNKMFDRLSEELDFPFKRIGSLVLCFDENDMDNLRKLKEQGEKNGV--PNLEILSG 120 Query: 127 KELQKREPNISKQAVGALVCNSSIAIDPVLLTTTLMRNAIKNGVELKVNSKVVDIKKVDN 186 ++++ EPN+SK+ V AL + + P +T L NA NGVE K+++KV+D+KK ++ Sbjct: 121 DKVRELEPNLSKKVVAALYAPTGAIVCPYEMTIALAENAADNGVEFKLDTKVLDVKKDND 180 Query: 187 IFEIKTAKDEIIQAEVVVNVAGHYADVIANMAGYGDFKLTTRRGEYRILDKSEAGIVNSV 246 + IKT K +++++V+N AG +AD I NM + R+G+Y + DK+ V+ Sbjct: 181 TYTIKTDKG-FVESKLVINAAGVFADEINNMVSSNKVHIIPRKGQYCLFDKAVGNTVSRT 239 Query: 247 VFMVPTIHGKGVIVAPMLDGRVMVGPTALDGVPKEETLLVTQQQYDNIGKIGKHLIPNIN 306 +F +PT GKGV+V P +DG +++GP A D + +E L T D I + I + Sbjct: 240 IFQLPTKMGKGVLVTPTVDGNLLIGPNAED-IGDKEDLATTSTGMDFIIEKAGLSINQVP 298 Query: 307 MDKTCTVYAGSRPIDIETNDFIIRPAKNDKKFINVAGMKSPAIASAPAIADMVCDLV 363 M + T ++G R +E DFII A++ K FIN AG++SP ++SAP+IA+++ D+V Sbjct: 299 MRQLITSFSGLRAHSVE-GDFIIGEAEDAKGFINAAGIESPGLSSAPSIAELIKDIV 354 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 478 Length adjustment: 32 Effective length of query: 355 Effective length of database: 446 Effective search space: 158330 Effective search space used: 158330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory