Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_017751970.1 PN53_RS03170 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_000816635.1:WP_017751970.1 Length = 373 Score = 146 bits (368), Expect = 1e-39 Identities = 111/352 (31%), Positives = 178/352 (50%), Gaps = 22/352 (6%) Query: 5 LDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVDGK 64 + ++SK G L ++L + G LLG++ GKT+ +RI+AG + PT G V + K Sbjct: 12 IKNVSKYFGDNQVLKKINLDIYKGEFLTLLGSSGCGKTTTLRIIAGFEIPTEGSVVIANK 71 Query: 65 DVTGMPVRDRNVAMVYQQFINYPSMKVAANIASPL--KLRGEKNIDARVREIASRLHIDM 122 D T + +R+V V+Q + +P M V NIA L K + I +V EI + ++ Sbjct: 72 DATNLQPYNRDVNTVFQSYALFPHMNVFDNIAFGLVEKKIKKSEIKKKVEEILELVQLNN 131 Query: 123 FLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQS 182 F R P+E+SGGQ+QRVA+ARAL ++LLDEPL LD KLR++++ EL L Sbjct: 132 FEKRKPSEMSGGQKQRVAIARALINNPKVLLLDEPLAALDLKLRKQMQLELKHLQQQLGV 191 Query: 183 TVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLMAAS 242 T VY T + EAL + V+++G L Q G E++ P + VA + N+ A+ Sbjct: 192 TFVYVTHDQEEALTMSDRIGVMNKGILEQIGTPKEIYEQPKTKFVADFIGE--SNIFEAT 249 Query: 243 ATAQGVRLQGGAELTLPLPQGAATAAG--------LTVGVRASALRVHARPGD-VSVAGV 293 V + G L L + G+ +A G +++ VR +++ P + + GV Sbjct: 250 -----VSKKIGKNLELVIEDGSVSAIGNEFKKNEIVSISVRLEHMKLSKEPIEGFCLNGV 304 Query: 294 VELAEISGSDTFVHASTPWGDLVAQLTGVHYFEL---GTAITLHLDPAQAYV 342 ++ +GS+ P G + +L EL GT + ++ D +A V Sbjct: 305 IKEHIYTGSNIKTVVQLPSGKCI-KLNNHPDTELNSKGTLVNVYWDLEKAVV 355 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 373 Length adjustment: 30 Effective length of query: 333 Effective length of database: 343 Effective search space: 114219 Effective search space used: 114219 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory