Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_017895233.1 PN53_RS13195 NAD(P)-dependent oxidoreductase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000816635.1:WP_017895233.1 Length = 316 Score = 140 bits (352), Expect = 5e-38 Identities = 83/237 (35%), Positives = 125/237 (52%), Gaps = 6/237 (2%) Query: 72 GFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIG 131 G++ D+ ++ I + N P T++ A + +L+ + + +K ++ + Sbjct: 78 GYNNIDMEAAKKKNITVCNVPGYSTDAVAQLAITFMLSLSSSLALQQTMIKQNNFDNFTK 137 Query: 132 PALFG-VDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVEL 190 +++ KTLG++G G IG +V + AL M VL NRS P + + V L Sbjct: 138 DLQVPHFEIKNKTLGVIGAGAIGQSVIK-TALSLGMNVLVYNRSVKPIKDVKF----VSL 192 Query: 191 AELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGT 250 ELL +DFV + PLT TKHLI +LK MK S+ +IN +RGA + E LIEAL Sbjct: 193 EELLKESDFVTIHCPLTDNTKHLIDIDKLKMMKTSSFIINTARGAIIKESDLIEALSKNI 252 Query: 251 IHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAAENLVAALDG 307 I GA LDV E EPL + SPL + NV+ PHIG E+R + +N+ + +DG Sbjct: 253 IAGAALDVQEKEPLDTKSPLFSMENVILTPHIGCKCIESRQRLIELLGKNIKSFIDG 309 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 316 Length adjustment: 27 Effective length of query: 294 Effective length of database: 289 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory