Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate WP_017895622.1 PN53_RS05335 SDR family oxidoreductase
Query= SwissProt::Q9HK58 (254 letters) >NCBI__GCF_000816635.1:WP_017895622.1 Length = 247 Score = 144 bits (364), Expect = 1e-39 Identities = 93/249 (37%), Positives = 137/249 (55%), Gaps = 3/249 (1%) Query: 1 MLDFKGKNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHK 60 M+D GK AV+TGGS IGRAI++ LAK GANI+++Y ++ EA L+ KYGV Sbjct: 1 MVDLSGKVAVVTGGSGDIGRAISIELAKCGANIIVNYRKNEIEARRTLDNIKKYGVTGII 60 Query: 61 VKVDQSDPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHY 120 + D S+ + + + A++ GK+ ILV+NAG+ F D + ++ V+++ Sbjct: 61 FQGDVSNYNSAKKLIDCAVDNMGKIDILVNNAGVSNIGLFIDADEDQWNRIIDVDLKGVL 120 Query: 121 FITQRIAKNMIENKINGRILLISSISAHVGGEFQTHYTTTKSALNGFMHSIAIVLGKYGI 180 T K MI K NG I+ ISSI G ++ Y+ K A+N F +IA + I Sbjct: 121 NCTHCALKYMISKK-NGIIVNISSIWGSEGASCESIYSAAKGAVNSFTKAIAKEMAPSNI 179 Query: 181 LVNSLEPGTILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTYVTG 240 VN++ PG I T +NK LSN E+ A ++ GR G ED+ FL S+ + Y+TG Sbjct: 180 RVNAVAPGVIDTKMNKW-LSNDERNALID-EIPSGRFGKTEDISNIVSFLCSESSRYITG 237 Query: 241 TELLADGGM 249 + DGGM Sbjct: 238 QIITVDGGM 246 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 247 Length adjustment: 24 Effective length of query: 230 Effective length of database: 223 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory