Align Triosephosphate isomerase; TIM; TPI; EC 5.3.1.1; Triose-phosphate isomerase (uncharacterized)
to candidate WP_017894859.1 PN53_RS04220 triose-phosphate isomerase
Query= curated2:A8MFY0 (248 letters) >NCBI__GCF_000816635.1:WP_017894859.1 Length = 257 Score = 197 bits (501), Expect = 2e-55 Identities = 104/248 (41%), Positives = 159/248 (64%), Gaps = 2/248 (0%) Query: 1 MRKPIIAGNWKMNKVSKE-ALDLVNQIKDEVHKTE-VEVVVCCPFTVLSQVQKALVGTNL 58 MRKPI+A +WKM+ S ++ +I++ V E VE+ + F ++S V K +N+ Sbjct: 1 MRKPIVASSWKMHINSLNIGMETARKIRNYVGNEEKVEMFILPTFPLISYVAKIFEDSNI 60 Query: 59 KLGAQNMHWEEDGAYTGEISANMLKDIGVEYVILGHSERRQYFNETDETVNKKVKKAIKE 118 G QNM +EE GA+TGE+ +LK++G YV +GH+ERR YFNET+E VNKKV+ A K Sbjct: 61 GYGGQNMCYEERGAFTGEVPPLILKELGSSYVEIGHAERRAYFNETNEDVNKKVRLAFKY 120 Query: 119 NLKPIVCIGESLEEREANQTFDVIKKQLLGAFEGVPAEAMDNVVLAYEPIWAIGTGKTAS 178 N+ P+VCIGE+ ++ + +K Q+L A + + E M NV+LAYEP+WAIG ++A Sbjct: 121 NMMPVVCIGENENDKIKKISSIKLKDQVLWALDKLNEENMKNVILAYEPVWAIGKQESAD 180 Query: 179 SEEAQTVIAYIRSLIEEKYGVDISEEVRIQYGGSVKASNATEIMNETDIDGALVGGASLK 238 S + V ++IR+ I++ YG ++SE +RI YGGSV +N ++ + +IDG +G LK Sbjct: 181 SNYVEHVHSFIRNEIQKNYGRNVSENIRIIYGGSVSINNIEKLAIKENIDGFFIGRFGLK 240 Query: 239 AEEFLGII 246 E F ++ Sbjct: 241 PENFRNMV 248 Lambda K H 0.313 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 257 Length adjustment: 24 Effective length of query: 224 Effective length of database: 233 Effective search space: 52192 Effective search space used: 52192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_017894859.1 PN53_RS04220 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.1729980.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-44 137.6 0.0 3.3e-44 137.4 0.0 1.0 1 NCBI__GCF_000816635.1:WP_017894859.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000816635.1:WP_017894859.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 137.4 0.0 3.3e-44 3.3e-44 1 228 [] 5 242 .. 5 242 .. 0.90 Alignments for each domain: == domain 1 score: 137.4 bits; conditional E-value: 3.3e-44 TIGR00419 1 lviinfK.lnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGaftG 71 +v +K +s++ + k+++ v +e++ve+ + p f ++ v++ e s+i + qn+ + GaftG NCBI__GCF_000816635.1:WP_017894859.1 5 IVASSWKmHINSLNIGMETARKIRNYVGNEEKVEMFILPTFPLISYVAKIFEdSNIGYGGQNMCYEERGAFTG 77 5778899666777777777889****************************9999******************* PP TIGR00419 72 eisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaa 144 e+ +lk+lG +v igH+ErR++++e++e ++kkv + + ++++vvC+ge ++++ ++i ++ + ++ NCBI__GCF_000816635.1:WP_017894859.1 78 EVPPLILKELGSSYVEIGHAERRAYFNETNEDVNKKVRLAFKYNMMPVVCIGENENDK--IKKISSIKLKDQV 148 ***************************************************9876655..5666666544444 PP TIGR00419 145 aA.........lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGasvtaaeda 207 ++++++A+EPv++iG ++ e v++++r+ ++k ++v+e++r++yG+sv+ ++ NCBI__GCF_000816635.1:WP_017894859.1 149 LWaldklneenMKNVILAYEPVWAIGKQESADSNYVEHVHSFIRNEIQKnYGRNVSENIRIIYGGSVSINNIE 221 333667778889***********************************99899********************* PP TIGR00419 208 elaaqldvdGvLlasavlkae 228 +la++ ++dG+ ++ lk+e NCBI__GCF_000816635.1:WP_017894859.1 222 KLAIKENIDGFFIGRFGLKPE 242 *************98888875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 13.68 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory