Align glucose-specific phosphotransferase enzyme IIA component; EC 2.7.1.- (characterized)
to candidate WP_039653499.1 PN53_RS12165 glucose PTS transporter subunit IIA
Query= CharProtDB::CH_088352 (169 letters) >NCBI__GCF_000816635.1:WP_039653499.1 Length = 667 Score = 137 bits (344), Expect = 5e-37 Identities = 63/151 (41%), Positives = 97/151 (64%) Query: 12 SDDKKDTGTIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMVAPVDGTIGKI 71 S+ K +G +++P GEIV +E+VPD F+EK++GDG A+ P+G+ + AP DG I + Sbjct: 510 SESKAVSGVNLLLSPADGEIVTLEEVPDPTFSEKLLGDGFAVIPSGDNIYAPADGEITVL 569 Query: 72 FETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVIEFDLPLLEEK 131 F T HAF+I + G+EL +H GIDTV L GEGF ++G +VK GD ++ D ++ K Sbjct: 570 FPTKHAFAITTAQGLELLIHIGIDTVALNGEGFTAHVKQGDKVKKGDLILNLDSKFIKSK 629 Query: 132 AKSTLTPVVISNMDEIKELIKLSGSVTVGET 162 K+ +TPV+++NMD + + G V +T Sbjct: 630 GKNMITPVIVTNMDIVDNIDIKKGKVDHAKT 660 Lambda K H 0.315 0.138 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 169 Length of database: 667 Length adjustment: 28 Effective length of query: 141 Effective length of database: 639 Effective search space: 90099 Effective search space used: 90099 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory