Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate WP_041096914.1 SUTH_RS02745 formate-dependent phosphoribosylglycinamide formyltransferase
Query= SwissProt::P33221 (392 letters) >NCBI__GCF_000828635.1:WP_041096914.1 Length = 416 Score = 434 bits (1117), Expect = e-126 Identities = 233/407 (57%), Positives = 290/407 (71%), Gaps = 23/407 (5%) Query: 4 LGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLD 63 +GT L P+ATRVMLLG GELGKEV I QRLG EVI VDRYADAP M VAHRSHV+ M D Sbjct: 7 IGTPLSPSATRVMLLGCGELGKEVIIALQRLGCEVIGVDRYADAPGMQVAHRSHVVAMTD 66 Query: 64 GDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEGL-----NVVPCARATKLTMNREGIR 118 G ALR ++E EKPH +VPEIEAIAT L+++E +G+ +P ARA +LTMNREGIR Sbjct: 67 GAALRALIEKEKPHLVVPEIEAIATAALVEMERDGVAGHFPEFIPTARAAQLTMNREGIR 126 Query: 119 RLAAEELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAW 178 RLAAEEL LPTS Y+FADS + + A+ IG+PC+VKPVMSSSGKGQ+ +++ + +AW Sbjct: 127 RLAAEELGLPTSPYKFADSLTELQAAIDTIGFPCVVKPVMSSSGKGQSLLKTPADVQKAW 186 Query: 179 KYAQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDG--------------VHFCAPVGHR 224 Y+Q GR GAGRVIVEG + FD+EITLLTV A+ FC P+GH Sbjct: 187 DYSQAAGRVGAGRVIVEGFIDFDYEITLLTVRALGASGADSTARASGAVETFFCEPIGHV 246 Query: 225 QEDGDYRESWQPQQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRP 284 Q +GDY ESWQP M+P AL+++++IAR + LGG G+FGVELF+ GD V FSEVSPRP Sbjct: 247 QVNGDYVESWQPMAMTPAALQKSRDIARAITGKLGGRGIFGVELFIKGDAVWFSEVSPRP 306 Query: 285 HDTGMVTLISQDLSEFALHVRAFLGLPV-GGIRQYGPAASAVILPQLTSQNVTFDNVQNA 343 HDTG+VTL +Q LSEF LH RA LGLPV +R+ P ASAVI L + F+ V +A Sbjct: 307 HDTGLVTLATQRLSEFELHARAILGLPVDASLRR--PGASAVIYGGLEETGIAFEGVADA 364 Query: 344 VGA-DLQIRLFGKPEIDGSRRLGVALATAESVVDAIERAKHAAGQVK 389 + + +RLFGKPE RR+GVA+A A++ +A +RAK AA +VK Sbjct: 365 LQVPESDLRLFGKPESFVKRRMGVAVANADTTDEARQRAKLAASRVK 411 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 416 Length adjustment: 31 Effective length of query: 361 Effective length of database: 385 Effective search space: 138985 Effective search space used: 138985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory