Align 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; EC 4.1.2.53; 2-dehydro-3-deoxyrhamnonate aldolase (uncharacterized)
to candidate WP_041098589.1 SUTH_RS08605 4-hydroxy-2-oxoheptanedioate aldolase
Query= curated2:B5R262 (267 letters) >NCBI__GCF_000828635.1:WP_041098589.1 Length = 265 Score = 266 bits (681), Expect = 3e-76 Identities = 135/242 (55%), Positives = 172/242 (71%), Gaps = 1/242 (0%) Query: 7 NPFKEGLRKGDTQIGLWLSSTTSYMAEIAATSGYDWLLIDGEHAPNTVQDLYHQLQAIAP 66 N FK LR+ Q+GL+++ +Y EI AT+G+DWLLIDGEHAPN + QLQA AP Sbjct: 6 NEFKRMLREKRLQVGLFVALANTYSMEILATAGFDWLLIDGEHAPNNPATVLPQLQAAAP 65 Query: 67 YASQPVIRPIEGSKALIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPLGQRGVGASV 126 Y Q V+RP+ ALIKQ LDIGAQTLL+PMV++ +A +V A RYPP G RGVG S+ Sbjct: 66 YPVQLVVRPVNHDTALIKQYLDIGAQTLLVPMVESVSEAAALVRAVRYPPQGMRGVGTSL 125 Query: 127 ARAARWGRIDNYMAQANESLCLLVQVESKVALENLDAILEVEGIDGVFIGPADLSASLGY 186 ARAARW + +Y AN+ +CL+VQ+ES+ L NLDAIL VEG+DG+FIGPADL+AS+GY Sbjct: 126 ARAARWNAVRDYAKHANDEICLIVQIESRQGLANLDAILMVEGVDGIFIGPADLAASMGY 185 Query: 187 PDNAGHPEVQRIIESCIYRIRAAGKAAGFLAVDPAMAQKCLAWGANFVAVGVD-TMLYTE 245 +GHPEV+ IE + RI A GKAAG +P +A+ L GA+F+AVG D T+L T Sbjct: 186 LGQSGHPEVKAAIEDAVKRIAATGKAAGVFVSEPKLARHYLDCGASFIAVGGDVTLLRTA 245 Query: 246 AL 247 AL Sbjct: 246 AL 247 Lambda K H 0.318 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 265 Length adjustment: 25 Effective length of query: 242 Effective length of database: 240 Effective search space: 58080 Effective search space used: 58080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory