Align Iron-sulfur cluster-binding protein (characterized, see rationale)
to candidate WP_041100478.1 SUTH_RS15420 LutB/LldF family L-lactate oxidation iron-sulfur protein
Query= uniprot:Q726S3 (717 letters) >NCBI__GCF_000828635.1:WP_041100478.1 Length = 473 Score = 286 bits (731), Expect = 2e-81 Identities = 169/444 (38%), Positives = 253/444 (56%), Gaps = 13/444 (2%) Query: 23 LRNAMDKFAVAYRASRANAFKDIDEKAIIAEVADA-KDHAAKNMDTLYAQFKAEAEKRGV 81 L+NA KF RA A KD+D+ + A A ++ N+D F+ +A G Sbjct: 25 LKNAKGKFVT----KRAEAIKDLDDFEGTRDAAVAIRNKVIDNLDLWLEAFERKALDTGA 80 Query: 82 KVHLARTAAEANEIIARIARDNNCKKAIKSKSMTAEETHLNHRLEEDNVEVIETDLGEWI 141 KV A+ AE ++ IA+ + KK KSKSM +EE LN LE ++ +ETDLGE+I Sbjct: 81 KVLWAKDGAEVCRLVVEIAKSHGVKKVTKSKSMLSEEAGLNQALEAAGIQPVETDLGEYI 140 Query: 142 IQM-RHEGPSHMVMPAIHLSRYQVADLFSEVTKQKQEVDIQRLVKVARRELRTHFATADM 200 +Q+ +E PSH++ PA+H S VADLF +V ++ +I L + AR LR HF +A+M Sbjct: 141 LQVDNNEPPSHIIAPAVHKSLDDVADLFHKVHGTPRKTEIPALTREAREVLRGHFLSAEM 200 Query: 201 GISGANFAVAETGTIGLVTNEGNARLVTTLPRVHVALAGLDKLVPTLHDALRSLKVLPRN 260 G+SG NF VAETG++ LVTNEGN R+VTTLP+VHV + G++K++PTL D +++LPR+ Sbjct: 201 GLSGGNFLVAETGSVALVTNEGNGRMVTTLPKVHVVITGIEKVIPTLEDLSTLMRLLPRS 260 Query: 261 ATGQAITSYVTWIGGANECEACVDGRKEMHIVFLDNGRRALAEDPLFSQVLRCVRCGACA 320 ATGQ+I++Y + + G + E DG + ++ V +D+GR + F +LRC+RCGAC Sbjct: 261 ATGQSISNYFSILTGVKKPEE-HDGPEHLYFVLVDSGRADVVGGD-FHAMLRCIRCGACM 318 Query: 321 NVCPVYRLVGGHKMGHIYIGAIGLILTYFFHGRDKARNLVQNCINCESCKHICAGGIDLP 380 N CPVY+ +GGH G +Y G +G +LT + G + + +L C C +C I LP Sbjct: 319 NHCPVYQTIGGHAYGWVYPGPMGSVLTPLYAGIENSIDLPHAATLCNQCGIVCPVKIPLP 378 Query: 381 RLIKEIRARLNEEEGMP----VETTLMGKMLKNRKLFHTLLRFAKWAQKPVTGGTPYIRH 436 L++++R + E P + L + + +L+ F K + G + IR Sbjct: 379 DLLRKLREKQTERGLRPLTERIGLRLWAWVAQQPRLYALGASFGARYLKWLAGDSNRIRV 438 Query: 437 LPQIFAKDHGFKALPAIADKPFRD 460 LP G + PA K FR+ Sbjct: 439 LPTAPEWTLG-RDFPAPQGKTFRE 461 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 782 Number of extensions: 39 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 473 Length adjustment: 36 Effective length of query: 681 Effective length of database: 437 Effective search space: 297597 Effective search space used: 297597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory