Align LUD_dom domain-containing protein (characterized, see rationale)
to candidate WP_197539602.1 SUTH_RS15415 lactate utilization protein C
Query= uniprot:A0A0C4YFN9 (234 letters) >NCBI__GCF_000828635.1:WP_197539602.1 Length = 219 Score = 81.6 bits (200), Expect = 1e-20 Identities = 71/227 (31%), Positives = 100/227 (44%), Gaps = 12/227 (5%) Query: 4 LSARERMLGRLRAAAPATTADASQLDARIDAHYDARREAATPAELAQAMQAALGASHALA 63 +S+RE +LGR+RA ++A+ R H + P A AL + Sbjct: 1 MSSREEILGRVRAGLHRNASNAAA--GREVMHAALANRGSGPQPAMDASPKALLERFRVK 58 Query: 64 WCASAEAWPAQLAGKLAAAGVRRLLLDPAAEQGAALMRALPASVAPLSYARP---IEAWK 120 + A V R L + A AL A L +A +EA Sbjct: 59 SELQSSTVDIVAEESAVPAAVARYLTSMTLPKAAVAQPAL----AHLDWAAAGLTVEARG 114 Query: 121 AELFDTVDAGFTVARSGIAATGTLVLAPDAQTPRTVSLVPPLHIALVYAETLHPDLHCAA 180 A D V G T +A TGTL++ TP TVSL+P HIA+V A + P + A Sbjct: 115 ARDADLV--GITGCFCAVAETGTLMVCSSPDTPATVSLLPETHIAVVRASRILPYMEDAW 172 Query: 181 RAERWSAG-MPTNLVLVSGPSKTSDIQQTLAYGAHGPRELWVIIVTG 226 R G +P + +SGPS+T DI+QT+ GAHGP + ++IV G Sbjct: 173 DLARKELGTLPRAVNFISGPSRTGDIEQTIVLGAHGPYRVHLVIVEG 219 Lambda K H 0.317 0.127 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 234 Length of database: 219 Length adjustment: 22 Effective length of query: 212 Effective length of database: 197 Effective search space: 41764 Effective search space used: 41764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory