Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_041097722.1 SUTH_RS05575 beta-ketothiolase BktB
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_000828635.1:WP_041097722.1 Length = 395 Score = 280 bits (716), Expect = 5e-80 Identities = 168/400 (42%), Positives = 227/400 (56%), Gaps = 9/400 (2%) Query: 2 REAFICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAG 61 RE + +R +G + G+LS + DL + ++E + R+ +D + + +G Sbjct: 5 REVVVLSAVRAAVGTFMGSLSGMEPADLGGLVVKEAIARSG-VDPKAVTFATVGNVIPTE 63 Query: 62 EDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMS 121 VAR AT+ G+ +NRLCGS A+ +A+AI GD D I GGVE MS Sbjct: 64 SRYPYVARNATIQGGMTMESVTFAVNRLCGSSQQAVVSSAQAILLGDADFAIGGGVEVMS 123 Query: 122 RAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISREDQ 181 R ++ + A A M DT + V L FG M TAEN+A+ ++RE Q Sbjct: 124 RGAYL----SPAMRSGARMGDTKMVDAMVAAL-TDPFGAGHMGITAENLAKKHNLTREMQ 178 Query: 182 DSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHLRPETTLEQLRGLKAP 241 D FA SQ+R A A ++G E+IVP+ LK +KG V DEH++ TT+E L +K Sbjct: 179 DEFACESQRRAAAAVAAGYFKEQIVPITLKTRKGDVV-FDTDEHIKANTTMESLAKMKPA 237 Query: 242 FRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGVEPRLMGLGPVP 301 F G +TAGNASG+NDGAA L++A AAA G P AR+V+ GV +MG GP+P Sbjct: 238 FDKAGTVTAGNASGINDGAAFLVLADAAKAAAGGHKPMARLVSYGIGGVSHEVMGEGPIP 297 Query: 302 ATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNGGAIALGHPLGM 361 +T L +AGL I D+ V+E NEAFAAQ+L V + LGL D NPNGGAIA+GHP+G Sbjct: 298 STLIALAKAGLKIADIGVVESNEAFAAQSLTVAKVLGL--DPKKTNPNGGAIAIGHPIGA 355 Query: 362 SGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401 SGA + A +E R +Y L TMCIG GQGI I E + Sbjct: 356 SGAVIITKALYEARRVGSKYCLATMCIGGGQGITTIWEMI 395 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 395 Length adjustment: 31 Effective length of query: 370 Effective length of database: 364 Effective search space: 134680 Effective search space used: 134680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory