Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate WP_041098264.1 SUTH_RS07380 acetyl-CoA C-acyltransferase
Query= SwissProt::P0C7L2 (401 letters) >NCBI__GCF_000828635.1:WP_041098264.1 Length = 398 Score = 280 bits (715), Expect = 7e-80 Identities = 174/411 (42%), Positives = 228/411 (55%), Gaps = 27/411 (6%) Query: 1 MREAFICDGIRTPIGRYG-GALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQ 59 +++A+I RTPIG+ G + R DDL ++ + + P LD + I+D I+GC+ Sbjct: 5 LQDAYIVAATRTPIGKAPRGMFRNTRPDDLLVYAIQSAMAQVPGLDPKLIEDAIIGCSFP 64 Query: 60 AGEDNRNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVES 119 GE N+AR A LLAGLP +V G T+NR C SG+ A+ AA I+ G D++IAGG ES Sbjct: 65 EGESGLNMARNAVLLAGLPNTVGGVTVNRFCASGITAVAMAADRIRVGQADVMIAGGAES 124 Query: 120 MSRAPFVMGKAASAFSRQAEMFDTTIGWRFVNPLMAQQFGTDSMPETAENVAELLKISRE 179 MS P MG + + D +G + M TAE VA KI+RE Sbjct: 125 MSMVP--MGGNHPSIN-MGVFKDENVGMAY------------GMGLTAEKVANQWKITRE 169 Query: 180 DQDSFALRSQQRTAKAQSSG-----ILAEEIVPVVLKNKKGVVT----EIQHDEHLRPET 230 QD FAL+S QR Q +G A EIV V G V + DE R ++ Sbjct: 170 MQDEFALQSHQRAIAGQQAGEFDNETTAVEIVDRVPNLATGEVDLKKRSVNRDEGARADS 229 Query: 231 TLEQLRGLKAPFRANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAMATAGV 290 L L LK F A G +TAGN+S +DGA ALI+ SE++ LTP AR V+ A GV Sbjct: 230 NLAALAKLKPVFAAKGSVTAGNSSQTSDGAGALILVSEKILKQFNLTPLARFVSFAVRGV 289 Query: 291 EPRLMGLGPVPATRRVLERAGLSIHDMDVIELNEAFAAQALGVLRELGLPDDAPHVNPNG 350 P +MG+GP A AG++ +D IELNEAFAAQ+L V+++L L D VNP G Sbjct: 290 PPEIMGIGPKEAIPVACRAAGITQDQLDWIELNEAFAAQSLAVIKDLDL--DPAKVNPIG 347 Query: 351 GAIALGHPLGMSGARLALAASHELHRRNGRYALCTMCIGVGQGIAMILERV 401 GAIALGHPLG +GA + H L RRN +Y + TMC+G G G A I ER+ Sbjct: 348 GAIALGHPLGATGAIRSATVIHALRRRNLKYGMVTMCVGTGMGAAGIFERM 398 Lambda K H 0.319 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 398 Length adjustment: 31 Effective length of query: 370 Effective length of database: 367 Effective search space: 135790 Effective search space used: 135790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory