Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_041097951.1 SUTH_RS06285 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000828635.1:WP_041097951.1 Length = 336 Score = 182 bits (461), Expect = 2e-50 Identities = 108/289 (37%), Positives = 161/289 (55%), Gaps = 31/289 (10%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 M ++ + + K F VK + + + I G ++GPSG GK+T LR++AGLE + Sbjct: 1 MASVSIRKVHKSFGA----VKVIQGIDVDIADGEFVVMVGPSGCGKSTLLRMVAGLETIS 56 Query: 61 SGYIYFDNEAVSSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 SG I D V+ + P+ R IAMVFQN+ALYP+M+V N+A+ LK+ ++ IE Sbjct: 57 SGEIAIDGRVVND-----LEPKDRNIAMVFQNYALYPHMSVRQNMAYGLKIRRMSSADIE 111 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 VK +E L L L+R P+ELSGGQ QR A+ RA+V++P V L DEP SNLDA++R Sbjct: 112 AHVKRAAEILELGPYLDRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDAKLRVQ 171 Query: 181 ARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLIA 240 RA ++ + R T+L V+HD + +A + V+ G+ QIG P ++Y PAT +A Sbjct: 172 MRAELQALHRRLATTSLYVTHDQVEAMTMAQRMIVMNAGRAEQIGAPLDVYAKPATTFVA 231 Query: 241 RLTGE--INLIQAKIIENNAIIANLKVPLNNMELKGQSNIVIGLRPDDL 287 G +NLI E + +I++G+RP+ L Sbjct: 232 GFIGSPPMNLIP--------------------EQRNGRDILLGIRPEHL 260 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 336 Length adjustment: 29 Effective length of query: 342 Effective length of database: 307 Effective search space: 104994 Effective search space used: 104994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory