Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_046008336.1 OLEAN_RS05080 ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000967895.1:WP_046008336.1 Length = 303 Score = 101 bits (252), Expect = 2e-26 Identities = 74/239 (30%), Positives = 124/239 (51%), Gaps = 17/239 (7%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTV-FL 61 + +NLT +YG K LN++S + +G+ AL+GPNG GKSTL + + SG L Sbjct: 5 IECQNLTKAYGNKKALNNISFEIQSGQPIALVGPNGAGKSTLFGILAGYIPATSGEAKIL 64 Query: 62 GDNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSA-EDNARVN 120 G N + S +L R+ LPQ L +T+Q+ +S+ L +GR A ++ ARV Sbjct: 65 GHN----VGSPELIGRIGALPQDALFNPNLTIQQQLSFLAR--LQGFGRSKAFKEAARV- 117 Query: 121 VAMNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRL 180 + ++ A ++T LS G ++R +A L +VLLDEPT LD + ++ + Sbjct: 118 --LELMQLADTAKEKITALSHGMKKRVAIAQALMGEPELVLLDEPTAGLDPENARNIRQQ 175 Query: 181 MGELRTQGKTVVAVLHDLNQASRYCDQLVVMANG-----HVMAQGTPEEVMTPGLLRTV 234 + L + T V H+L + R C+Q++ + G H++ Q T ++ ++ +R V Sbjct: 176 VMALSDE-TTFVISSHNLEELERLCEQVLYLDQGELKAQHIIGQQTEQQTLSYLTVRLV 233 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 303 Length adjustment: 25 Effective length of query: 230 Effective length of database: 278 Effective search space: 63940 Effective search space used: 63940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory