Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate WP_211262496.1 NITAL_RS18085 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b21105 (288 letters) >NCBI__GCF_000969705.1:WP_211262496.1 Length = 300 Score = 181 bits (458), Expect = 2e-50 Identities = 103/286 (36%), Positives = 161/286 (56%), Gaps = 9/286 (3%) Query: 5 ASHRLRRRLLKVAHLA---GLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSL 61 A+HR RR V+ LA L+ LV+ P L +VL+SLRPT EI A P + +PE +SL Sbjct: 20 ATHRRTRRRPTVSSLAIGAVLWGYALVVVAPLLLVVLNSLRPTSEIFADP-IALPERVSL 78 Query: 62 DAYRAMFSGAGQGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLG 121 D+Y ++ A G YF NSL +++ S ++A + + Y RYRF+ SA+ L Sbjct: 79 DSYATAWTDANFGR-----YFFNSLGITIASVLLATTVSVLAAYPLGRYRFRGSSALSLF 133 Query: 122 FMLTRAVPGIALSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDLA 181 F+ +P LPLF+L ++DT L+L Y A +PF+++++ FFRQ+P DLA Sbjct: 134 FLSGLMLPFRLAILPLFLLLDGLNLVDTRSGLVLVYAATGIPFSVFILTAFFRQLPGDLA 193 Query: 182 EAAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVGL 241 +AA IDG +Q F +V PL P +++ +F F+ WN++ + RS + TLPVG+ Sbjct: 194 DAAAIDGAGEFQIFSRVMLPLVRPALSTVMVFQFVPLWNDFFFPLVLLRSSDKWTLPVGM 253 Query: 242 LDYTAEFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVK 287 + E+ DW + A ++ +P + L + +++GLT G K Sbjct: 254 TRFFGEYQTDWSTLFAGLLIATLPLIVLFLAATRQIIAGLTAGIGK 299 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 300 Length adjustment: 26 Effective length of query: 262 Effective length of database: 274 Effective search space: 71788 Effective search space used: 71788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory