Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate WP_211262496.1 NITAL_RS18085 carbohydrate ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >NCBI__GCF_000969705.1:WP_211262496.1 Length = 300 Score = 142 bits (358), Expect = 9e-39 Identities = 88/275 (32%), Positives = 142/275 (51%), Gaps = 14/275 (5%) Query: 13 SRIAIYATLLLAAAVYLIPLVVMLLTSFKSPEDIRTGNLLSWPTVIDGIGWIKAWDVV-- 70 S +AI A L A V + PL++++L S + +I + ++ P + + AW Sbjct: 32 SSLAIGAVLWGYALVVVAPLLLVVLNSLRPTSEI-FADPIALPERVSLDSYATAWTDANF 90 Query: 71 GGYFWNSVKITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVLLPAS 130 G YF+NS+ IT+ +VL++T + + Y L +RFRGS L G LPF+ +LP Sbjct: 91 GRYFFNSLGITIASVLLATTVSVLAAYPLGRYRFRGSSALSLFFLSGLMLPFRLAILPLF 150 Query: 131 FTLGKFGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDGAGFFTIFLKI 190 L L +T +GLVLV+ G+ F+ ++ +P L AA +DGAG F IF ++ Sbjct: 151 LLLDGLNLVDTRSGLVLVYAATGIPFSVFILTAFFRQLPGDLADAAAIDGAGEFQIFSRV 210 Query: 191 LLPMSIPIVMVCLIWQFTQIWNDFLFG-VVFASGDAQPITVALNNLVNTSTGAKEYNVD- 248 +LP+ P + +++QF +WNDF F V+ S D + V + EY D Sbjct: 211 MLPLVRPALSTVMVFQFVPLWNDFFFPLVLLRSSDKWTLPVGMTRFFG------EYQTDW 264 Query: 249 ---MAAAMIAGLPTLLVYIFAGKYFLRGLTSGAVK 280 A +IA LP +++++ A + + GLT+G K Sbjct: 265 STLFAGLLIATLPLIVLFLAATRQIIAGLTAGIGK 299 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 300 Length adjustment: 26 Effective length of query: 255 Effective length of database: 274 Effective search space: 69870 Effective search space used: 69870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory