Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_083442198.1 NITAL_RS14765 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::D4GV57 (219 letters) >NCBI__GCF_000969705.1:WP_083442198.1 Length = 220 Score = 144 bits (363), Expect = 1e-39 Identities = 80/206 (38%), Positives = 113/206 (54%), Gaps = 9/206 (4%) Query: 12 RLADSGVVAVMRGADADTIIDVADALHEGGVTAYEITADNPDAMDLIREVSASFSDNEAI 71 ++ +GV+ ++R D + VADAL GG+T EIT P A DLI E++ + + + Sbjct: 13 QVTSAGVIGIVRERDGERARTVADALLAGGLTVIEITLTTPGATDLIAELADRCAGTDVL 72 Query: 72 VGAGTALDAPTANAAIQAGAEFVVGPNFDEGVVETCNRYGTLVAPGIMTPTEATDAYSAG 131 VGAGT LD A A++AGA F+V P+ V +R+G + PG T TEA A G Sbjct: 73 VGAGTILDEDAAARAVRAGARFIVSPHLSVAAVHVAHRHGVVAIPGAATVTEAVTAIECG 132 Query: 132 ADLVKVFPASSLGPGHLKSMKGPLPQIPMMPTGGVGLDNAADYIEAGAVVVGAGGALMDD 191 AD VK+FPA G +S+ LP +P++PTGG+G + ++ AGA VG GG L Sbjct: 133 ADAVKLFPAGVHGIDWFRSLHAVLPPVPLIPTGGIGPADVGRWLGAGAAAVGLGGQL--- 189 Query: 192 EAIENGDFEAITETAREFSNIIDDAR 217 GD E +T E ++D AR Sbjct: 190 ---SRGDAEEVTARVGE---VVDCAR 209 Lambda K H 0.314 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 220 Length adjustment: 22 Effective length of query: 197 Effective length of database: 198 Effective search space: 39006 Effective search space used: 39006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory