Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_211262376.1 NITAL_RS12270 SDR family oxidoreductase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_000969705.1:WP_211262376.1 Length = 298 Score = 125 bits (315), Expect = 8e-34 Identities = 84/252 (33%), Positives = 129/252 (51%), Gaps = 14/252 (5%) Query: 11 LRDRGVLVTGGGSGIGAALVEAFARQGARVAFVDIAAESSLALCEKVAAQTGQAPHFIQA 70 L RGV+V G G GIG + A A+ GA+V +D E++ VAA+ P A Sbjct: 44 LDGRGVVVAGAGQGIGRQVTHALAQCGAQVFCLDADPEAAA----HVAAEVDGVP--ATA 97 Query: 71 DLRNVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFMC 130 D+R + V AA +A + G + +V+ LEA T+E WD + + LRH + + Sbjct: 98 DVRERDEVEAALWDAADRFGRLDAIVDIVGMARYAPLEATTDEDWDWTFGMVLRHAYLLS 157 Query: 131 QAVAPHMQRQGG-------GSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGP 183 Q A M+ Q G++ S++ + P AY AKAG++ L +SLA +LGP Sbjct: 158 QVGAAVMRGQDRDAATGQRGAMAFVGSVSGMTGAPYHAAYGAAKAGLLSLVRSLAVELGP 217 Query: 184 DNIRVNAILPGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAA 243 IR NA+ PG++ T R + + +E R L+R+ D+ G L+L SD +A Sbjct: 218 SGIRANAVAPGVVWTPRIAAM-VGDEGKERNARNAPLRRVAEPSDVAGALLYLVSDLAAY 276 Query: 244 MTAQAMIIDGGV 255 ++ Q + +DGGV Sbjct: 277 VSGQVLAVDGGV 288 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 298 Length adjustment: 25 Effective length of query: 231 Effective length of database: 273 Effective search space: 63063 Effective search space used: 63063 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory