Align BadH (characterized)
to candidate WP_052666329.1 NITAL_RS11395 3-oxoacyl-ACP reductase FabG
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000969705.1:WP_052666329.1 Length = 243 Score = 172 bits (437), Expect = 4e-48 Identities = 105/246 (42%), Positives = 139/246 (56%), Gaps = 12/246 (4%) Query: 9 AVITGGGGGIGGATCRRFAQEGAKIAV-FDLNLDAAEKVAGAIRDAGGTAEAVRCDIADR 67 A+++GG GGIG A CR A G + V + N DAAEKV +AEAV D+ D Sbjct: 9 ALVSGGSGGIGAAICRHLAAAGHTVLVGYGGNRDAAEKVVADC----ASAEAVHLDVTDE 64 Query: 68 TSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHHAVLP 127 SV AA+A LG + ++VNNAG + +P ++R + +NL GA + A L Sbjct: 65 ESVTAAVARAAE-LGTLAVVVNNAGVADDDLLLRLDPTRFDRTLEVNLRGAYLLSRAALR 123 Query: 128 GMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVVCPGP 187 M+ RHGRIVNIAS A G+ G+ Y A K GL+ +K+LARE AR G+TVNVV PG Sbjct: 124 PMMRARHGRIVNIASIVALRGNPGQTAYGASKAGLIGLTKSLAREIARKGVTVNVVAPGF 183 Query: 188 TDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITGQVLSV 247 +TA+ ++ P+ EA P GR D++A A+ F SD+AG ITG VL V Sbjct: 184 VETAMTDEL------PDAAREALLGLAPTGRAVTADEVAAAVGFLASDEAGAITGAVLPV 237 Query: 248 SGGLTM 253 GG M Sbjct: 238 DGGAAM 243 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 243 Length adjustment: 24 Effective length of query: 231 Effective length of database: 219 Effective search space: 50589 Effective search space used: 50589 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory