Align BadH (characterized)
to candidate WP_052666468.1 NITAL_RS12240 SDR family oxidoreductase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000969705.1:WP_052666468.1 Length = 262 Score = 142 bits (359), Expect = 5e-39 Identities = 90/249 (36%), Positives = 126/249 (50%), Gaps = 5/249 (2%) Query: 3 RLQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRC 62 RL ++ A++TG G GIG AT FA+ GA + + ++VA I + G A V Sbjct: 7 RLTDQVAIVTGAGRGIGAATAVAFAEAGADVVISSRTAADLDRVAKTIAELGRRAVVVEA 66 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMH 122 D+ D +V A + + LG VD++VNN G + +P T G ER N+T A+ + Sbjct: 67 DLDDTGAVAALVDAAVSDLGGVDVVVNNVGGTMPRPLLDTSDGFLERAFHFNVTTAVALV 126 Query: 123 HAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNV 182 A P M+ER G +VNI+S RV G Y KG L ++ LA + A I VN Sbjct: 127 RAAAPVMLERGGGSVVNISSVMGRVAGRGYLAYGVAKGALSHATRLLAADLAPR-IRVNA 185 Query: 183 VCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITG 242 + G T+ L V E L A A PL RLG+PD++A A F S G++TG Sbjct: 186 LEVGSVATSALDIVVEN----EPLRTAMESATPLRRLGQPDEVAAAALFLASAAGGYVTG 241 Query: 243 QVLSVSGGL 251 + L V GG+ Sbjct: 242 RTLPVDGGI 250 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory