Protein WP_050461858.1 in Herbaspirillum autotrophicum IAM 14942
Annotation: NCBI__GCF_001189915.1:WP_050461858.1
Length: 481 amino acids
Source: GCF_001189915.1 in NCBI
Candidate for 16 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-tryptophan catabolism | aroP | hi | Amino acid permease (characterized, see rationale) | 69% | 99% | 642.5 | L-alanine and D-alanine permease | 38% | 334.3 |
| D-alanine catabolism | cycA | med | L-alanine and D-alanine permease (characterized) | 38% | 93% | 334.3 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 38% | 323.2 |
| L-alanine catabolism | cycA | med | L-alanine and D-alanine permease (characterized) | 38% | 93% | 334.3 | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs | 38% | 323.2 |
| L-threonine catabolism | RR42_RS28305 | lo | D-serine/D-alanine/glycine transporter (characterized, see rationale) | 39% | 96% | 334 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-phenylalanine catabolism | aroP | lo | Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs (characterized) | 38% | 96% | 323.2 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-proline catabolism | proY | lo | Proline-specific permease (ProY) (characterized) | 36% | 98% | 318.9 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-histidine catabolism | permease | lo | histidine permease (characterized) | 36% | 95% | 315.5 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-tyrosine catabolism | aroP | lo | Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) | 36% | 95% | 313.5 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-arginine catabolism | rocE | lo | Amino-acid permease RocE (characterized) | 37% | 97% | 307.4 | L-alanine and D-alanine permease | 38% | 334.3 |
| phenylacetate catabolism | H281DRAFT_04042 | lo | Aromatic amino acid transporter AroP (characterized, see rationale) | 36% | 97% | 305.8 | L-alanine and D-alanine permease | 38% | 334.3 |
| D-serine catabolism | cycA | lo | D-serine/D-alanine/glycine transporter (characterized) | 34% | 97% | 283.1 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-asparagine catabolism | ansP | lo | L-asparagine permease; L-asparagine transport protein (characterized) | 34% | 95% | 282.3 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-lysine catabolism | lysP | lo | Lysine permease LysP (characterized) | 34% | 95% | 271.2 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-serine catabolism | serP | lo | Serine permease SerP1 (characterized) | 31% | 98% | 224.9 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-threonine catabolism | serP1 | lo | Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) | 32% | 94% | 224.9 | L-alanine and D-alanine permease | 38% | 334.3 |
| L-tryptophan catabolism | TAT | lo | tryptophan permease (characterized) | 30% | 72% | 199.1 | L-alanine and D-alanine permease | 38% | 334.3 |
Sequence Analysis Tools
View WP_050461858.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MHDPTQQFQKIIERERGLQRSLTPGQMSMIAIGGAIGTGLFLGSGFAIGFAGPSVLLSYA
IGAVIAIVLMGCLAEMTVAHPTSGSFGAYAEHYISPWAGFMVRYAYWACIVLAVGTEVTA
IALYMKYWFPAVPGWFWIASFSAALVLINAFSVKVFGAVEYWFSLIKIAAIVGFILLGAY
IVFVAPASLANVGGTAQLAGFHHYVEHGGFFPHGAWGMWVAVIIAIFSYLSIEMIAVAAG
EAKDPETAVTSAFRSTVVRLVLFYLLTLALMLAIVPWTAASHDRSPFVMVMEAINTPGAA
GVINFVVLVAALSSMNSQLYITTRMMFSLSRGGYAPQRLGQVNRRGVPLAALLLSTVGIA
LAVLLSVVYPDASFTIMMAIAMFGALFTWMMIFVTHYFFRRHWNRHGKIPLRFRMIGFPV
LTLLGAGLMLAIMTTTLFVAEFRMTLIFGVPFLILLSLAYFFWYGRRASAPVRDTASKLS
S
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory