Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate WP_050460765.1 AKL27_RS01335 MFS transporter
Query= reanno::Koxy:BWI76_RS23715 (445 letters) >NCBI__GCF_001189915.1:WP_050460765.1 Length = 430 Score = 308 bits (788), Expect = 3e-88 Identities = 160/415 (38%), Positives = 238/415 (57%), Gaps = 7/415 (1%) Query: 15 QRTHKKIYRHLMPLLIVAYIISFIDRTNIGMAKATMSVDIGLSATAFGLGAGLFFLTYAV 74 + T K+ L+PLL + Y+ S++DR N+G AK M D+ S T +GLGAG+FF+ Y + Sbjct: 13 EATFSKVTWRLLPLLFLCYVASYLDRVNVGFAKLQMLADLKFSETVYGLGAGIFFIGYFI 72 Query: 75 LEIPSNLFLTRIGARRWIARIMITWGIISCGMAFVTGPTSFYVMRLLLGAAEAGLYPGII 134 E+PSN+ L ++GAR WIARIMITWGIIS M +VT P FYVMR LLG AEAG +PG+I Sbjct: 73 FEVPSNIILHKVGARLWIARIMITWGIISGAMIYVTTPEMFYVMRFLLGVAEAGFFPGVI 132 Query: 135 YYLTLWFGREERAKATGLFLLGVCLANIIGAPLGGLLL-SLDGMSGWHGWQWMFFIEGLP 193 YLT W+ R K T LF+ G+ L+ +IG PL G ++ S+ G+ G GWQWMF +E +P Sbjct: 133 LYLTYWYPSHRRGKITALFMTGIALSGVIGGPLSGWIMHSMPGVYGMSGWQWMFILEAIP 192 Query: 194 AIALAFVVWRRLPDKPADARWLDSHDVQAITAVLEKEAEETRHTPSRFSLKTALTTRVFL 253 ++ L V+ + D+ DA WL + Q + + ++ EA + + T S+ Sbjct: 193 SLVLGVVIIFYMKDRIRDADWLSETEKQLLESQIKAEASQKQET----SMGQMFANPKVW 248 Query: 254 LLVLIYFTHQFSVYGLSYFLPGIIGSWGQLTPLQIGLLTAIPWIAAAAGGILLPRFARTE 313 L LIYF +YG+S++LP II + G PL IGLLTAIP+ AA +L+ R A Sbjct: 249 LSALIYFCFVMGLYGVSFWLPTIIKTTGVTDPLNIGLLTAIPYAFAAVAMVLVGRSADKH 308 Query: 314 QRSRSMLMAGYLVMATGMAIGAIAGHG--VALLGFSLAAFMFFAMQSIIFNWLPSIMSGH 371 + R + + A G+ + + H VA+ +LA + ++ + + G Sbjct: 309 RERRWHVAIPAFLGAIGLLLSTMYDHNTIVAMAALTLATIGIMTTLPLFWSLPTAFLGGA 368 Query: 372 MLAGSFGLLNCLGLCGGFLGPFILGAFEDRTGAATSGLWFAVALLIVGALASLLI 426 A L+N LG GF+ P+++G +D T + SG++ A L++G L +L + Sbjct: 369 AAAAGIALINSLGNLAGFVSPYLVGWLKDATQSTNSGMYVLAASLVLGGLLTLTV 423 Lambda K H 0.328 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 430 Length adjustment: 32 Effective length of query: 413 Effective length of database: 398 Effective search space: 164374 Effective search space used: 164374 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory