Align 2-deoxy-D-ribose dehydrogenase α subunit (characterized)
to candidate WP_050461571.1 AKL27_RS04390 (2Fe-2S)-binding protein
Query= metacyc::MONOMER-20832 (151 letters) >NCBI__GCF_001189915.1:WP_050461571.1 Length = 155 Score = 164 bits (414), Expect = 7e-46 Identities = 79/143 (55%), Positives = 101/143 (70%), Gaps = 2/143 (1%) Query: 5 INQKAYQVDADADTPLLWVIRDDLGLTGTKYGCGLAQCGACSVLVDGNVVRSCVTPVAGV 64 +N K V A+ DTPLLWVIRD++GLTGTK+GCG+A CGAC+V +DG VRSC TPV+ V Sbjct: 7 LNGKPVTVTAEPDTPLLWVIRDEIGLTGTKFGCGVALCGACTVHLDGAPVRSCQTPVSAV 66 Query: 65 VGREITTIEAIETDEVGKRVVATWVEHQVAQCGYCQSGQVMAATALLKHTPAPSKAQIDA 124 G+++ TIE++ D + W+ H V QCGYCQSGQ+M+A+ALL+ PS ID Sbjct: 67 SGKQVATIESLSKDN-SHPLQKAWIAHDVPQCGYCQSGQLMSASALLQTNKNPSDTDIDN 125 Query: 125 AMI-NLCRCGTYNAIHAAVDDLA 146 AM N+CRCGTYN I AA+ A Sbjct: 126 AMSGNICRCGTYNRIRAAIKSAA 148 Lambda K H 0.320 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 151 Length of database: 155 Length adjustment: 17 Effective length of query: 134 Effective length of database: 138 Effective search space: 18492 Effective search space used: 18492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory