Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_050465263.1 AKL27_RS23275 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001189915.1:WP_050465263.1 Length = 252 Score = 207 bits (527), Expect = 2e-58 Identities = 106/242 (43%), Positives = 159/242 (65%) Query: 24 LSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLFNGDSIG 83 +SK+FGGL+ + V +G I GLIGPNGAGKTT+FNL++ +R G ++F+G+ IG Sbjct: 7 ISKNFGGLQVLQGVQFEVPQGGIFGLIGPNGAGKTTVFNLITGLLRASSGNIVFDGEDIG 66 Query: 84 QLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQKEERAN 143 +APH+I RG RTFQ +V +T+LEN+++ F L+N +K E+ Sbjct: 67 NVAPHKITERGIARTFQNIRVFKEMTLLENVVVGMHDHLNYGFGGLLLNLGSFRKIEKEA 126 Query: 144 REKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGVNPTLIG 203 RE+A+ +L V L KA+ A +LS G+++ LE ARAL + PKL+LLDEP AG+NP+ Sbjct: 127 RERALELLSWVRLDHKAEMLADSLSYGEQRKLEFARALATKPKLLLLDEPVAGMNPSEKT 186 Query: 204 QICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSDPRVLEAY 263 ++ I+N ++G + +IEH+M +M LC V VL G+ +A+GTP+QI+++ V+EAY Sbjct: 187 ELMTEILNIKQRGFSIFMIEHDMRFVMGLCDRVAVLNFGKIIAEGTPDQIKNNQEVIEAY 246 Query: 264 LG 265 LG Sbjct: 247 LG 248 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 252 Length adjustment: 24 Effective length of query: 243 Effective length of database: 228 Effective search space: 55404 Effective search space used: 55404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory