Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_050461953.1 AKL27_RS06300 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= uniprot:D8J1T6 (255 letters) >NCBI__GCF_001189915.1:WP_050461953.1 Length = 660 Score = 239 bits (611), Expect = 8e-68 Identities = 122/248 (49%), Positives = 166/248 (66%) Query: 5 LLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTFEL 64 LL+ + V +FGGL+ALN V + I +G ++GLIGPNG+GK+T NV+TG+Y+P G E Sbjct: 389 LLEAKQVLMQFGGLKALNRVDLNIVKGSVHGLIGPNGSGKSTMMNVLTGIYKPTDGAVEF 448 Query: 65 DGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVRTKQNVFGAVFRHKAAR 124 +G S + P +A G+ARTFQN++LFGEMT ENV+VG H K NVF + + + Sbjct: 449 NGVVISGATPSAIALGGVARTFQNVQLFGEMTATENVLVGLHHTFKSNVFDVMVQTPRYK 508 Query: 125 EEEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALDEPAAGM 184 EE R ++ +L FVG+ A AR+L YG QR LEI RAL +P LL LDEPAAG+ Sbjct: 509 REEREARVRAAAILQFVGLADLANEEARNLPYGKQRLLEIGRALGLNPNLLLLDEPAAGL 568 Query: 185 NATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADVQKNP 244 A + L ++ KI+ G TI+LIEH + ++M + + +TVLD+G+ IAEG PA VQ +P Sbjct: 569 TAPDIKELVAIIRKIRQSGITIILIEHHMDVVMSISDTVTVLDFGQKIAEGKPAAVQADP 628 Query: 245 AVIEAYLG 252 VIEAYLG Sbjct: 629 KVIEAYLG 636 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 419 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 660 Length adjustment: 31 Effective length of query: 224 Effective length of database: 629 Effective search space: 140896 Effective search space used: 140896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory