Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 208 bits (529), Expect = 2e-58 Identities = 104/237 (43%), Positives = 157/237 (66%), Gaps = 1/237 (0%) Query: 4 IQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIYIG 63 +++ D+ K +G+ A D +S I+ + + L+GPSG GK+T LRM+AGLETP SGDIYI Sbjct: 3 VEMRDICKNYGNFRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYID 62 Query: 64 GDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAETLG 123 G +N R I VFQ+YAL+ +MTV N+ FGLE + E +RV E+ E G Sbjct: 63 GQRVNDVPAAKRGIGFVFQNYALFRYMTVYDNVAFGLELAK-VPKKEIKKRVTELLELTG 121 Query: 124 IADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQDQ 183 ++ + R P++LSGGQ+QRVA RA+ +P+V L+DEP + +DAK+R E+R L+ + + Sbjct: 122 LSGMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVVK 181 Query: 184 LAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMI 240 L +T+++VTH+Q EA+ +AD I + + G ++Q+ +P E Y P+ FVA+FIG I Sbjct: 182 LGITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIGRSSI 238 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 352 Length adjustment: 30 Effective length of query: 353 Effective length of database: 322 Effective search space: 113666 Effective search space used: 113666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory