Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 207 bits (527), Expect = 4e-58 Identities = 134/368 (36%), Positives = 208/368 (56%), Gaps = 34/368 (9%) Query: 8 DVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGELRL 67 D+ K Y G+ A + +S I+ G+ + L+GPSG GK+T LRM+AGLET G++ + Sbjct: 7 DICKNY-----GNFRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYI 61 Query: 68 EDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTDML 127 + + +N V A R I VFQ+YAL+ + +V N++FGLE + +P EI++RV E ++ Sbjct: 62 DGQRVNDVPAAKRGIGFVFQNYALFRYMTVYDNVAFGLELAK-VPKKEIKKRVTELLELT 120 Query: 128 GISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRLQG 187 G+S + R P QLSGGQ+QRVA RA+ +P+V L+DEP + +DAK+R E+R L+ + Sbjct: 121 GLSGMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVV 180 Query: 188 ELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSMNL 247 +LG+T+++VTHDQ EA+ + D + + + G ++Q+GTP++ Y P+ FVA FIG Sbjct: 181 KLGITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIGR----- 235 Query: 248 FDGSLSGDTFRGDGFDYPLSGATRDQLGGASGLTLGIRPEDVTVGERRSGQRTFDAEVVV 307 S+ R GFD P+ GAT IRPE V + Q AE + Sbjct: 236 --SSIVEHYERLLGFD-PVEGATH----------AVIRPEFVRMSRSEPPQHMSAAERGI 282 Query: 308 VEP---QGNENAVHLRFVDGDEGTQF-TATTTGQSRVEAGDRTTVSFPEDAIHLFDGETG 363 V+ +GN HL V G T + + VE G++ V +++FD Sbjct: 283 VKDVIFRGN----HLDVVVDVGGIPIVTERSLEKDPVEIGEQVYVLIYR--LYIFDENQT 336 Query: 364 DALKNREL 371 ++N+E+ Sbjct: 337 YLVENKEM 344 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 352 Length adjustment: 30 Effective length of query: 353 Effective length of database: 322 Effective search space: 113666 Effective search space used: 113666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory