Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 159 bits (403), Expect = 5e-44 Identities = 86/236 (36%), Positives = 140/236 (59%), Gaps = 6/236 (2%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITIK 61 +++ + K++G ++S I +G++VA++GPSGSGK+T LR + LE PN G I I Sbjct: 3 VEMRDICKNYGNFRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYID 62 Query: 62 DTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAEDLL 121 + + + IG VFQ++ LF + TV +N+ + + + K K+ +++ +LL Sbjct: 63 GQRVN----DVPAAKRGIGFVFQNYALFRYMTVYDNVAFG-LELAKVPKKEIKKRVTELL 117 Query: 122 RKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMVKEVLQVMKE 181 GL YPN+LSGGQ+QRVA ARALA NP ++L DEP +A+D ++ E+ ++E Sbjct: 118 ELTGLSGMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLRE 177 Query: 182 L-VETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFL 236 + V+ G+T + VTH+ A EVAD ++ + G I + G P E + SP + F+ Sbjct: 178 MVVKLGITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFI 233 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 352 Length adjustment: 26 Effective length of query: 214 Effective length of database: 326 Effective search space: 69764 Effective search space used: 69764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory