Align ATPase (characterized, see rationale)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 152 bits (385), Expect = 7e-42 Identities = 83/232 (35%), Positives = 142/232 (61%), Gaps = 7/232 (3%) Query: 29 KWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSH 88 K YGN F+A VS +++G++V ++GPSGSGK+T LR + LE+ G+I+I+G R++ Sbjct: 10 KNYGN-FRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYIDGQRVN- 67 Query: 89 DRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIA 148 D+ ++ +G VFQ + LF ++TV N+ +++ + P + + +LLE ++ Sbjct: 68 ---DVPAAKRGIGFVFQNYALFRYMTVYDNVAFG-LELAKVPKKEIKKRVTELLELTGLS 123 Query: 149 EQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLASE-G 207 +YP QLSGGQ+QRVA ARALA P++LL DEP +A+D ++ E+ + +R++ + G Sbjct: 124 GMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVVKLG 183 Query: 208 MTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQ 259 +T + TH+ A EVAD +++ G I + P + +P + QF+ + Sbjct: 184 ITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIGR 235 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 352 Length adjustment: 27 Effective length of query: 234 Effective length of database: 325 Effective search space: 76050 Effective search space used: 76050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory