Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 150 bits (378), Expect = 4e-41 Identities = 89/253 (35%), Positives = 148/253 (58%), Gaps = 21/253 (8%) Query: 2 ISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVIVD 61 + ++++ K YG+F+ S ++KG+++ + GPSGSGK+TL++ + LE GD+ +D Sbjct: 3 VEMRDICKNYGNFRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYID 62 Query: 62 GTSIADPKTNLPKLRSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRSKEEASKKALQLL 121 G + D +P + +G VFQ++ LF ++++ DN+ +++ K+E K+ +LL Sbjct: 63 GQRVND----VPAAKRGIGFVFQNYALFRYMTVYDNVAFG-LELAKVPKKEIKKRVTELL 117 Query: 122 ERVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALD----PEMVNEVLD 177 E GLS K++P QLSGGQ+QRVA ARALA +P V+L DEP +A+D E+ N + + Sbjct: 118 ELTGLSGMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLRE 177 Query: 178 VMVQLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKI--------IEDCKKEEFFGDITA 229 ++V+L G+T + VTH+ A +VAD +I + G I I F Sbjct: 178 MVVKL---GITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIG 234 Query: 230 RSDRAQHFLEKIL 242 RS +H+ E++L Sbjct: 235 RSSIVEHY-ERLL 246 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 352 Length adjustment: 26 Effective length of query: 218 Effective length of database: 326 Effective search space: 71068 Effective search space used: 71068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory