Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate WP_022046526.1 M72_RS04110 ABC transporter ATP-binding protein
Query= TCDB::Q9WXN4 (268 letters) >NCBI__GCF_001406815.1:WP_022046526.1 Length = 338 Score = 177 bits (448), Expect = 3e-49 Identities = 97/244 (39%), Positives = 153/244 (62%), Gaps = 10/244 (4%) Query: 23 IEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLPPTS----GEIYFEGKDIWKDI 78 + AV VSF ++ + + +VGESGSGK+ T+ I+++L T GE+ + G+DI K Sbjct: 25 VRAVNGVSFNLEPGKTLGIVGESGSGKSVTSYSIMQILAETGKITGGEVLYRGEDISK-- 82 Query: 79 KDRESLVEFR-RKVHAVFQDPFASYNPFYPVERTLWQAISLLENKPSNKKEALELIKESL 137 + + + +FR K +FQDP S NP + + L +AI L +K +KK+A E E L Sbjct: 83 WNEKQMQKFRGEKCSIIFQDPMTSLNPVFTIGNQLMEAILLHTDK--DKKQARERAIEML 140 Query: 138 FRVGI-DPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEPTSMIDASSRGGIIKL 196 VG+ +P+ L +YPH++SGG +QR+MIA + P +++ADEPT+ +D + + I++L Sbjct: 141 TLVGVNEPESRLKQYPHELSGGMRQRVMIAMALVCEPDILIADEPTTALDVTIQAQILEL 200 Query: 197 LEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDKVVLEPTHEYTKLLVG 256 +++L+++ G +II +THDLG+ + D I VM G + ERG D + P HEYTK L+ Sbjct: 201 MQDLQKKLGMAIIMVTHDLGVIASMCDEIIVMYGGRVCERGTADAIFYHPAHEYTKGLLR 260 Query: 257 SIPK 260 SIPK Sbjct: 261 SIPK 264 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 338 Length adjustment: 27 Effective length of query: 241 Effective length of database: 311 Effective search space: 74951 Effective search space used: 74951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory