Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= TCDB::P96483 (377 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 199 bits (507), Expect = 7e-56 Identities = 121/304 (39%), Positives = 168/304 (55%), Gaps = 22/304 (7%) Query: 20 AVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGGAIRIGDRDVTHLPPKDRDI 79 A D + IE G+ + L+GPSG GK+T LRM+AGLE N G I I + V +P R I Sbjct: 17 ASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYIDGQRVNDVPAAKRGI 76 Query: 80 AMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAAKILDLTQYLDRKPKALSGG 139 VFQNYAL+ +MTV DN+ F L++A VPK EI+++V E ++ L+ R P LSGG Sbjct: 77 GFVFQNYALFRYMTVYDNVAFGLELAKVPKKEIKKRVTELLELTGLSGMEKRYPNQLSGG 136 Query: 140 QRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIASLQRRLGITTVYVTHDQVEA 199 QRQRVA RA+ PQV L+DEP + +DAK+R R + + +LGIT+++VTHDQ EA Sbjct: 137 QRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVVKLGITSIFVTHDQDEA 196 Query: 200 MTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIG--------------SPAMNLVE 245 + + D + + G ++Q+ +P +Y P FVA FIG P Sbjct: 197 VEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIGRSSIVEHYERLLGFDPVEGATH 256 Query: 246 VPITDGGVKFGNSVVPVNREALSAADKGDRTVTVGVRPEHFD-VVELGG---AVAASLSK 301 I V+ S P + +SAA++G V R H D VV++GG SL K Sbjct: 257 AVIRPEFVRMSRSEPP---QHMSAAERG-IVKDVIFRGNHLDVVVDVGGIPIVTERSLEK 312 Query: 302 DSAD 305 D + Sbjct: 313 DPVE 316 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 308 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 352 Length adjustment: 29 Effective length of query: 348 Effective length of database: 323 Effective search space: 112404 Effective search space used: 112404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory