Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 205 bits (522), Expect = 1e-57 Identities = 114/267 (42%), Positives = 161/267 (60%), Gaps = 5/267 (1%) Query: 20 LQLKTIRKAFGSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGSVQID 79 ++++ I K +G+ + ++ G+ V +GPSG GK+TLLR IAGLE SG + ID Sbjct: 3 VEMRDICKNYGNFRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYID 62 Query: 80 GVEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAGMLSL 139 G V V AKRGI VFQ+YAL+ ++TV DN+ GL+ A VPK EI+++V + + L Sbjct: 63 GQRVNDVPAAKRGIGFVFQNYALFRYMTVYDNVAFGLELAKVPKKEIKKRVTELLELTGL 122 Query: 140 EPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARLHRSL 199 R P +LSGGQRQRVA RA+ P++ L DEP + +DA +R R + + L Sbjct: 123 SGMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVVKL 182 Query: 200 KATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQMNFIE 259 T I+VTHDQ EA+ +AD+I++ N G IEQ+G+PME+Y P FVA FIG + Sbjct: 183 GITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIGRSSIVEHY 242 Query: 260 AAKLG----DGEAKTIGIRPEHIGLSR 282 LG +G + IRPE + +SR Sbjct: 243 ERLLGFDPVEGATHAV-IRPEFVRMSR 268 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 352 Length adjustment: 29 Effective length of query: 323 Effective length of database: 323 Effective search space: 104329 Effective search space used: 104329 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory