Align TreV, component of Trehalose porter (characterized)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 203 bits (516), Expect = 6e-57 Identities = 114/268 (42%), Positives = 163/268 (60%), Gaps = 4/268 (1%) Query: 1 MTVELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKII 60 M VE+ DI K YG + ++ IE G+ +LGPSG GK+TLL+++AG+E + G I Sbjct: 1 MYVEMRDICKNYGNFRASDHVSFGIEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIY 60 Query: 61 ADGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLL 120 DG + D P KR + VFQNYAL+ M+V DN+AF L++ + K+EI +RV + +L Sbjct: 61 IDGQRVNDVPAAKRGIGFVFQNYALFRYMTVYDNVAFGLELAKVPKKEIKKRVTELLELT 120 Query: 121 GISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQK 180 G+S + + Q+SGGQ+QRVA ARA+ NP LLDEP + +DA+VRT R L+ + Sbjct: 121 GLSGMEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVV 180 Query: 181 ELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPM-- 238 +L T I+VTHDQ EA+ +AD I I + G EQ+ P +Y+ P T +VAQF+G + Sbjct: 181 KLGITSIFVTHDQDEAVEVADEIIITNHGHIEQMGTPMEIYKSPDTPFVAQFIGRSSIVE 240 Query: 239 --NFLPGELMKEKAQEIGFRPEWVEVGK 264 L G E A RPE+V + + Sbjct: 241 HYERLLGFDPVEGATHAVIRPEFVRMSR 268 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 352 Length adjustment: 28 Effective length of query: 296 Effective length of database: 324 Effective search space: 95904 Effective search space used: 95904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory