Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate WP_022046731.1 M72_RS03885 ABC transporter ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >NCBI__GCF_001406815.1:WP_022046731.1 Length = 352 Score = 204 bits (519), Expect = 3e-57 Identities = 103/210 (49%), Positives = 140/210 (66%) Query: 27 IGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPARERNVAMVFQNYA 86 I G+ V LLGPSG GK+T+LRMIAGLE + G + I G VND+PA +R + VFQNYA Sbjct: 25 IEKGKLVALLGPSGSGKTTLLRMIAGLETPNSGDIYIDGQRVNDVPAAKRGIGFVFQNYA 84 Query: 87 LYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPRAMSGGQQQRAAIA 146 L+ +M+VYDN+AFGL K P EI +RV E+ L L + +R P +SGGQ+QR A A Sbjct: 85 LFRYMTVYDNVAFGLELAKVPKKEIKKRVTELLELTGLSGMEKRYPNQLSGGQRQRVAFA 144 Query: 147 RAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQLEAMTLADRVI 206 RA+ P V L DEP + +DAK+R +LR ++ + +L T+++VTHDQ EA+ +AD +I Sbjct: 145 RALAPNPQVLLLDEPFAAIDAKVRTELRNWLREMVVKLGITSIFVTHDQDEAVEVADEII 204 Query: 207 LMQDGRIVQAGSPAELYRYPRNLFAAGFIG 236 + G I Q G+P E+Y+ P F A FIG Sbjct: 205 ITNHGHIEQMGTPMEIYKSPDTPFVAQFIG 234 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 352 Length adjustment: 30 Effective length of query: 376 Effective length of database: 322 Effective search space: 121072 Effective search space used: 121072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory