GapMind for catabolism of small carbon sources

 

Protein WP_057507534.1 in Stenotrophomonas chelatiphaga DSM 21508

Annotation: NCBI__GCF_001431535.1:WP_057507534.1

Length: 229 amino acids

Source: GCF_001431535.1 in NCBI

Candidate for 39 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-Glucosamine, putative ATPase component (characterized) 40% 86% 145.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 35% 80% 139.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 60% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 60% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 60% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 60% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 60% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 33% 60% 135.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 37% 58% 134.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 36% 65% 134 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 36% 65% 133.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 36% 53% 131.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
trehalose catabolism thuK lo Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized) 38% 50% 131.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 32% 66% 127.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
lactose catabolism lacK lo LacK, component of Lactose porter (characterized) 34% 60% 126.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 60% 125.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-maltose catabolism thuK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 60% 125.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 60% 125.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 60% 125.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 59% 123.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 59% 123.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 35% 58% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 33% 57% 113.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 34% 83% 109 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 34% 83% 109 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 34% 83% 109 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 34% 83% 109 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 34% 83% 109 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 34% 83% 109 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 88% 106.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 81% 105.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 81% 105.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 32% 80% 95.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 32% 80% 95.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 48% 216.1

Sequence Analysis Tools

View WP_057507534.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSTLVSLRSITKTYQRGPEQVKVLHGIDLDIETGDFVALMGPSGSGKTTLLNLIGGLDSP
SGGEITIEGERIDQMGGGQLSTWRSHHVGFVFQFYNLMPMLTAQKNVELPLLLTHLGAAQ
RRRNAEIALTLVGLADRRSHRPNELSGGQQQRVAIARAIVSDPTFLICDEPTGDLDRQSA
EEILQLLQQLNREHGKTIIMVTHDPKAAEYATHTVHLDKGELADAPLAH

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory