Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 223 bits (568), Expect = 7e-63 Identities = 135/326 (41%), Positives = 180/326 (55%), Gaps = 11/326 (3%) Query: 2 GQIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDIY 61 G + + DL K F VAVDD++LD+ E L+G SG GKST LR L G ETPT G I Sbjct: 19 GYLSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIV 78 Query: 62 IGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAET 121 + G + P R + M+FQ YAL+PHM+V QNI FGL+++ G RV E+ E Sbjct: 79 LDGQPLVALPPYKRPVNMMFQSYALFPHMSVEQNIAFGLKQD-GLAGDAIRRRVGEMLEL 137 Query: 122 LGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNLQ 181 + + L R+P +LSGGQQQRVAL R++ + P++ L+DEP+ LD KLR++M+ EL N+ Sbjct: 138 VHMTSLAKRRPHQLSGGQQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVNII 197 Query: 182 DQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMIN 241 + VT V VTH+Q EAMTMA RIAVMD G +QQV P E Y +P N FVA FIG +N Sbjct: 198 ETSGVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVYEQPANRFVAGFIGS--VN 255 Query: 242 LVRGTRSES-----TFVGEHFSYPLDEDVMESVDDRDDFVLGVRPEDIEVADAAPDDAAL 296 G E T F P+ + + VRPE I + P+ Sbjct: 256 SFEGVIDEDLPEYVTVRSPAFPAPIYIGHGITCYEGQPVAFAVRPEKIIIGKDEPEGHTN 315 Query: 297 DDHDLQMDVTVVEPHGDQNVLHLSHP 322 + D+ G +V H+ P Sbjct: 316 KAQGVIEDIAY---FGSHSVYHVRLP 338 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 378 Length adjustment: 30 Effective length of query: 353 Effective length of database: 348 Effective search space: 122844 Effective search space used: 122844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory