Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_057507944.1 ABB28_RS06925 acyl-CoA dehydrogenase family protein
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_001431535.1:WP_057507944.1 Length = 382 Score = 211 bits (538), Expect = 2e-59 Identities = 132/382 (34%), Positives = 203/382 (53%), Gaps = 6/382 (1%) Query: 15 LDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYG 74 +D TEE+ M++D A + AQ+K+AP R + A + +GE GL+G +P +YG Sbjct: 1 MDFSFTEEQLMLQDVARRIAQEKIAPSAEHHDRTGEFPLANIQLLGENGLMGIEVPAEYG 60 Query: 75 GSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWI 134 G+G++ + Y L EV D+ + ++MSV +SL I G EAQKQKY+ +A G I Sbjct: 61 GAGMDPIAYVLAMVEVAAGDAAHSTIMSVNNSLFCNGILTHGNEAQKQKYVRAIAEGTAI 120 Query: 135 GCFGLTEPNHGSDPGSMITRA-RKVDGGYRLTGSKMWITNSPIADVFVVWAKDDAG---- 189 G F LTEP GSD +M RA ++ DG Y + G K WIT+ P+A V++A DA Sbjct: 121 GAFALTEPQSGSDATAMRCRAVKQADGSYVINGKKSWITSGPVAKYIVLFAMTDADKGAR 180 Query: 190 DIRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVM-DNVFVPEENIFPDVRGLKGPFTCL 248 I F+++ G K+G+RAS T EI D V E+ + + G K L Sbjct: 181 GISAFLIDTDNAGFGRGKTEPKLGIRASATCEIEFNDYVAQAEDLLGQEGEGFKIAMGVL 240 Query: 249 NSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGC 308 ++ R GI+ A+G A A + +Y +R+ FG + Q+ Q K+ADM+ ++ AL Sbjct: 241 DAGRIGIASQAIGIARAAYEATLEYVKERKAFGAAIGTFQMTQAKIADMKCKLDAALLLT 300 Query: 309 LRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVV 368 LR +K EG +I K + A+ I A + GG G S E + R+ + ++ Sbjct: 301 LRAAWVKGEGKRFSNEAAIAKLTASEAAMWITHQAVQIHGGMGYSKEMPLERYFRDAKIT 360 Query: 369 NTYEGTHDVHALILGRAQTGIQ 390 YEGT ++ L++ R +TG++ Sbjct: 361 EIYEGTSEIQRLVIARNETGLR 382 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 382 Length adjustment: 30 Effective length of query: 363 Effective length of database: 352 Effective search space: 127776 Effective search space used: 127776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory