Align ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_774 (244 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 150 bits (378), Expect = 5e-41 Identities = 82/224 (36%), Positives = 138/224 (61%), Gaps = 6/224 (2%) Query: 2 ISIKNVNKWYGDFQVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKGDVIVD 61 +SI+++ K + F + D + +V+KGE+ + G SGSGKSTL++C+ E +G +++D Sbjct: 21 LSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLD 80 Query: 62 GTSIADPKTNLPKLRSRVGMVFQHFELFPHLSIMDNLTIAQVKVLGRSKEEASKKALQLL 121 G P LP + V M+FQ + LFPH+S+ N+ +K G + + ++ ++L Sbjct: 81 G----QPLVALPPYKRPVNMMFQSYALFPHMSVEQNIAFG-LKQDGLAGDAIRRRVGEML 135 Query: 122 ERVGLSAHAKKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEV-LDVMV 180 E V +++ AK+ P QLSGGQQQRVA+AR+LA P ++L DEP ALD ++ +++ L+++ Sbjct: 136 ELVHMTSLAKRRPHQLSGGQQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVN 195 Query: 181 QLAHEGMTMMCVTHEMGFARKVADRVIFMDQGKIIEDCKKEEFF 224 + G+T + VTH+ A +A R+ MD G I + K +E + Sbjct: 196 IIETSGVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVY 239 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 378 Length adjustment: 27 Effective length of query: 217 Effective length of database: 351 Effective search space: 76167 Effective search space used: 76167 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory