Align L-asparagine permease; L-asparagine transport protein (characterized)
to candidate WP_057509355.1 ABB28_RS14795 amino acid permease
Query= SwissProt::P77610 (499 letters) >NCBI__GCF_001431535.1:WP_057509355.1 Length = 460 Score = 251 bits (640), Expect = 5e-71 Identities = 137/415 (33%), Positives = 227/415 (54%), Gaps = 7/415 (1%) Query: 29 AMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPALALVYLICGLFSFFILRALGELVLHR 88 A+ RQ+ M+ +G AIG GLFLG+G +Q+AGPA+ L YL+ G ++ ALGE+ ++ Sbjct: 19 ALKPRQLIMMGLGSAIGAGLFLGSGVGVQLAGPAVLLSYLVAGALVIIVMNALGEMAANK 78 Query: 89 PSSGSFVSYAREFLGEKAAYVAGWMYFINWAMTGIVD-ITAVALYMHYWGAFGGVPQWVF 147 P+SG+F YA + LG A GW++++ + + + A L W G+ + Sbjct: 79 PTSGAFSVYAADALGPTAGATVGWLWWVQLVIVIAAEAVGAAGLLATVW---TGLSVPMA 135 Query: 148 ALAALTIVGTMNMIGVKWFAEMEFWFALIKVLAIVTFLVVGTVFLGSGQPLDGNTTGFHL 207 ALA + +N++GVK F E EFWFA++KV AI+ F+ +G L P D + G Sbjct: 136 ALAFMLFFTAINLLGVKNFGEFEFWFAILKVAAILGFIAIGAALLLGWLP-DATSPGLSN 194 Query: 208 ITDNGGFFPHGLLPALVLIQGVVFAFASIEMVGTAAGECKDPQTMVPKAINSVIWRIGLF 267 T NGGF P GL + V+FAF E+V AA E +DP+ + +AI +V WRI +F Sbjct: 195 FTGNGGFAPTGLAGVGAALLVVIFAFGGTEIVAVAAAETEDPERSIARAIRTVAWRILVF 254 Query: 268 YVGSVVLLVMLLPWSAYQAGQSPFVTFFSKLGVPYIGSIMNIVVLTAALSSLNSGLYCTG 327 Y+GS+ +++ ++PW++ +A +SPF +P G+ + +V + A LS+LN+ LY Sbjct: 255 YIGSLSVIIAVVPWTS-EALKSPFAAVLEAANIPGAGTAITLVAVIALLSALNANLYGAS 313 Query: 328 RILRSMAMGGSAPSFMAKMSRQHVPYAGILATLVVYVVGVFLNYLVPSRVFEIVLNFASL 387 R++ S+A AP+ + R+ VP +LA+++ + + P RV ++LN Sbjct: 314 RMIFSLAQRREAPAVLGWADRRQVPVLAVLASVLFGFAATVMELVFPDRVLPVLLNIVGS 373 Query: 388 GIIASWAFIIVCQMRLRKAIKEGKAADVSFKLPGAPFTSWLTLLFLLSVLVLMAF 442 + W ++ Q+ LR+ A + F++ P+ + L L L + L+ + Sbjct: 374 TCLLVWTLSLLSQLVLRRRADRAGVA-LPFRMAAFPWLTALALAILALIFALLLY 427 Lambda K H 0.327 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 620 Number of extensions: 42 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 460 Length adjustment: 34 Effective length of query: 465 Effective length of database: 426 Effective search space: 198090 Effective search space used: 198090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory