Align ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc04256 (361 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 217 bits (553), Expect = 4e-61 Identities = 124/306 (40%), Positives = 180/306 (58%), Gaps = 4/306 (1%) Query: 4 VSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQIFIK 63 +S+RDL F +D +NLD+ GE LLG SG GKSTLL C+ G + G I + Sbjct: 21 LSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLD 80 Query: 64 DRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEILQI 123 + + P R + M+FQSYAL+P M+VE+N++FGLK + I +RV E++ + Sbjct: 81 GQPLVALPPYKRPVNMMFQSYALFPHMSVEQNIAFGLKQDGLAGDAIRRRVGEMLELVHM 140 Query: 124 QPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLHQSL 183 L KR+P +LSGGQ+QRVA+ R+L + + L DEP+ LD KLRS++++E+ + ++ Sbjct: 141 TSLAKRRPHQLSGGQQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVNIIETS 200 Query: 184 KNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMNFFR 243 T + VTHDQ EA+T+A RIAVM +G IQQ+ P +Y P N FVAGFIG S+N F Sbjct: 201 GVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVYEQPANRFVAGFIG--SVNSFE 258 Query: 244 GEVEPKDGRSFVRAGGIAFDVTAYPAH-TRLQPGQKVVLGLRPEHVKVDEARDGEPTHQA 302 G ++ +D +V AF Y H GQ V +RPE + + + T++A Sbjct: 259 GVID-EDLPEYVTVRSPAFPAPIYIGHGITCYEGQPVAFAVRPEKIIIGKDEPEGHTNKA 317 Query: 303 VVDIEE 308 IE+ Sbjct: 318 QGVIED 323 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 378 Length adjustment: 30 Effective length of query: 331 Effective length of database: 348 Effective search space: 115188 Effective search space used: 115188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory