Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::P96483 (377 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 346 bits (887), Expect = e-100 Identities = 189/385 (49%), Positives = 245/385 (63%), Gaps = 33/385 (8%) Query: 1 MATVTFDKATRIYPGSDKPAVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGG 60 MA V ++Y + AV + DGE +VLVGPSGCGKST LRM+AGLE+++GG Sbjct: 1 MAKVQLQGVRKVYDNG-QVAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEISGG 59 Query: 61 AIRIGDRDVTHLPPKDRDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAA 120 + IG+R V + PKDRDIAMVFQ+YALYPHMTVA+N+ F LK+ G KA I +++ EAA Sbjct: 60 TLTIGERVVNDVAPKDRDIAMVFQSYALYPHMTVAENLAFGLKLRGHDKATIDKRISEAA 119 Query: 121 KILDLTQYLDRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAS 180 + L LT +D+ PKA+SGGQRQRVA+GRA+VREP VFL+DEPLSNLDAKLR S RT+IA Sbjct: 120 QTLGLTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQ 179 Query: 181 LQRRLGITTVYVTHDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPA 240 L R+LG T +YVTHDQVEAMT+G R+ VLKDG++QQ+D+P +YD+PANLFVAGF+GSPA Sbjct: 180 LHRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFLGSPA 239 Query: 241 MNLVE---------VPITDGGVKFGNSVVPVNREALSAADKGDRTVTVGVRPEHFDVVEL 291 MN++ V ++DG K ++ L D+ + VGVRPEH + Sbjct: 240 MNVLRGTLQASASGVVVSDGDWKAPLGHATIDPRWL------DKPIAVGVRPEHLQPADA 293 Query: 292 GGAVAASLSKDSADAPAGLAVSVNVVEELGADGYVYGTAEVGGEVKDLVVRVNGRQVPEK 351 G + + P G + VN+V A L +RV R +P Sbjct: 294 GAEWTFEARIEGIE-PVGNEIFVNLVSGQHA----------------LTMRVAPRALPAV 336 Query: 352 GSTLHVVPRPGETHVFSTSTGERLS 376 G TL + +P H F TGERL+ Sbjct: 337 GETLKLAVQPNALHFFDAETGERLN 361 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 362 Length adjustment: 30 Effective length of query: 347 Effective length of database: 332 Effective search space: 115204 Effective search space used: 115204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory