Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_057508907.1 ABB28_RS12160 methionine ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_001431535.1:WP_057508907.1 Length = 335 Score = 150 bits (380), Expect = 3e-41 Identities = 96/252 (38%), Positives = 140/252 (55%), Gaps = 17/252 (6%) Query: 27 LQVEGIHKRYGEH----EVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGV 82 ++ + +HK Y L+ + L ++G+V +IG SG+GKST++R IN LE P G Sbjct: 2 IEFQRLHKSYAVAGRAISALQPLDLTIQEGEVFGIIGHSGAGKSTLIRMINRLEDPSGGR 61 Query: 83 ITLDGISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLD 142 + + G + + AG L+ LR R+ M+FQHFNL S TV N+ P + Sbjct: 62 LLIAGEDVTALE-TAG--------LRTLRRRIGMIFQHFNLLSSRTVASNVAF-PLELAG 111 Query: 143 VSAAEAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSA 202 A+ + R L VGL + AD+YPA LSGGQ+QRV IARALA P+I+L DE TSA Sbjct: 112 TPRAQIDARVAELLQTVGLQAH-ADKYPAQLSGGQKQRVGIARALATGPQILLCDEATSA 170 Query: 203 LDPELVGEVLKVIQTLAEE-GRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDAR-ILD 260 LDP+ VL ++ + E G T++++THEM R+V +V L G + E G + Sbjct: 171 LDPQTTASVLALLSKINRELGLTIVLITHEMDVIRRVCDRVAVLDAGEMVEMGPVTDVFL 230 Query: 261 QPNSERLQQFLS 272 P ++F+S Sbjct: 231 HPQHPTTRRFVS 242 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 335 Length adjustment: 27 Effective length of query: 249 Effective length of database: 308 Effective search space: 76692 Effective search space used: 76692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory