Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 202 bits (513), Expect = 2e-56 Identities = 110/284 (38%), Positives = 169/284 (59%), Gaps = 3/284 (1%) Query: 4 LEIRNIRKRYGEVETLKGIDIALESGEFLVLLGSSGCGKSTLLNIIAGLAEPSGGDILIG 63 L IR++RK + + +++ + GE LLG SG GKSTLL + G P+ G I++ Sbjct: 21 LSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLD 80 Query: 64 ERSVLGVHPKDRDIAMVFQSYALYPNLSVARNIGFGLEMRRVPQAEHDKAVRDTARLLQI 123 + ++ + P R + M+FQSYAL+P++SV +NI FGL+ + + V + L+ + Sbjct: 81 GQPLVALPPYKRPVNMMFQSYALFPHMSVEQNIAFGLKQDGLAGDAIRRRVGEMLELVHM 140 Query: 124 ENLLDRKPSQLSGGQRQRVAIGRALVRNPQVFLFDEPLSNLDAKLRMEMRTELKRLHQML 183 +L R+P QLSGGQ+QRVA+ R+L + P++ L DEP+ LD KLR +M+ EL + + Sbjct: 141 TSLAKRRPHQLSGGQQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVNIIETS 200 Query: 184 RTTVVYVTHDQIEAMTLATRIAVMRDGRIEQLAAPDEVYDRPATLYVAGFVGSPPM--NI 241 T V VTHDQ EAMT+ATRIAVM G I+Q+ PDEVY++PA +VAGF+GS + Sbjct: 201 GVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVYEQPANRFVAGFIGSVNSFEGV 260 Query: 242 LDAEMTANGLKIEGCEEVLPLPAAFNGAAWAGRRVKVGIRPEAL 285 +D ++ + + P+ + G+ V +RPE + Sbjct: 261 IDEDL-PEYVTVRSPAFPAPIYIGHGITCYEGQPVAFAVRPEKI 303 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 378 Length adjustment: 30 Effective length of query: 330 Effective length of database: 348 Effective search space: 114840 Effective search space used: 114840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory