Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 146 bits (369), Expect = 5e-40 Identities = 85/242 (35%), Positives = 131/242 (54%), Gaps = 5/242 (2%) Query: 2 IELKNVNKYYGTHHV-LKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 ++L+ V K Y V +K+ V +GE +V++GPSG GKST +R + GLEE+S G + + Sbjct: 4 VQLQGVRKVYDNGQVAVKDATFEVADGELMVLVGPSGCGKSTLLRMIAGLEEISGGTLTI 63 Query: 61 NNLVLNHKNKIEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKYL 120 V+N + + AMVFQ + LYPHMTV +NL +KL+ K ++ + Sbjct: 64 GERVVNDVAPKD---RDIAMVFQSYALYPHMTVAENLAFG-LKLRGHDKATIDKRISEAA 119 Query: 121 KVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKE 180 + +GL D + P +SGGQ+QRVA+ R+L + L DEP S LD + V + + Sbjct: 120 QTLGLTDMMDKLPKAMSGGQRQRVALGRALVREPAVFLLDEPLSNLDAKLRHSVRTEIAQ 179 Query: 181 ISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGKIL 240 + + TTM+ VTH+ A + RI+ ++DG I + + P E + P FLG Sbjct: 180 LHRKLGTTMIYVTHDQVEAMTLGQRIVVLKDGVIQQIDTPMELYDRPANLFVAGFLGSPA 239 Query: 241 KN 242 N Sbjct: 240 MN 241 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 362 Length adjustment: 26 Effective length of query: 216 Effective length of database: 336 Effective search space: 72576 Effective search space used: 72576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory