Align GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate WP_057508148.1 ABB28_RS08100 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::G3LHY8 (358 letters) >NCBI__GCF_001431535.1:WP_057508148.1 Length = 362 Score = 184 bits (466), Expect = 4e-51 Identities = 108/294 (36%), Positives = 164/294 (55%), Gaps = 16/294 (5%) Query: 27 GTLNVLLGPTLAGKTSLMRLMAGLDRPTGGSIHFDGTDVTGMPVQKRNVAMVYQQFINYP 86 G L VL+GP+ GK++L+R++AGL+ +GG++ V + + R++AMV+Q + YP Sbjct: 30 GELMVLVGPSGCGKSTLLRMIAGLEEISGGTLTIGERVVNDVAPKDRDIAMVFQSYALYP 89 Query: 87 ALTVYNNIASPMRISGKDAATIDREVRKAAELLKLTPYLDRTPLNLSGGQQQRTALARAL 146 +TV N+A +++ G D ATID+ + +AA+ L LT +D+ P +SGGQ+QR AL RAL Sbjct: 90 HMTVAENLAFGLKLRGHDKATIDKRISEAAQTLGLTDMMDKLPKAMSGGQRQRVALGRAL 149 Query: 147 VKNASLVLMDEPLANLDYKLREELREELPKIFAQSGAIFVYATTEPSEALLLGGNTATLN 206 V+ ++ L+DEPL+NLD KLR +R E+ ++ + G +Y T + EA+ LG L Sbjct: 150 VREPAVFLLDEPLSNLDAKLRHSVRTEIAQLHRKLGTTMIYVTHDQVEAMTLGQRIVVLK 209 Query: 207 QGRVTQFGPTIEVYRRPVNLATAGIFADPPLNTLDVTKSGNVFTRPSGVTI-------PV 259 G + Q +E+Y RP NL AG P +N L G + SGV + P+ Sbjct: 210 DGVIQQIDTPMELYDRPANLFVAGFLGSPAMNVL----RGTLQASASGVVVSDGDWKAPL 265 Query: 260 PSHLAVVP---DGPVTIAFHPHHLGLAPQTGDAARLQARTLVSEITGSESFVHL 310 H + P D P+ + P HL A G +AR E G+E FV+L Sbjct: 266 -GHATIDPRWLDKPIAVGVRPEHLQPA-DAGAEWTFEARIEGIEPVGNEIFVNL 317 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 362 Length adjustment: 29 Effective length of query: 329 Effective length of database: 333 Effective search space: 109557 Effective search space used: 109557 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory