Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_057507764.1 ABB28_RS05960 polyamine ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_001431535.1:WP_057507764.1 Length = 378 Score = 155 bits (391), Expect = 2e-42 Identities = 86/192 (44%), Positives = 118/192 (61%), Gaps = 3/192 (1%) Query: 23 ALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEG-PGAER-- 79 A+ V+ +VR + +LG SG GKSTLLR + G + T G ++LDG P+ P +R Sbjct: 35 AVDDVNLDVRKGEIFALLGGSGSGKSTLLRCLGGFETPTRGSIVLDGQPLVALPPYKRPV 94 Query: 80 GMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLSGG 139 M+FQSY LFP +++EQNI FGL++ G+ + R + V + + P QLSGG Sbjct: 95 NMMFQSYALFPHMSVEQNIAFGLKQDGLAGDAIRRRVGEMLELVHMTSLAKRRPHQLSGG 154 Query: 140 MQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDIDEA 199 QQR A+AR+LA PK+LL+DEP GALD + R MQ L+ I E T + VTHD +EA Sbjct: 155 QQQRVALARSLAKGPKLLLLDEPMGALDKKLRSQMQLELVNIIETSGVTCVMVTHDQEEA 214 Query: 200 IFMANRVAVFSA 211 + MA R+AV A Sbjct: 215 MTMATRIAVMDA 226 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 378 Length adjustment: 27 Effective length of query: 232 Effective length of database: 351 Effective search space: 81432 Effective search space used: 81432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory