Align Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC 2.3.1.168) (characterized)
to candidate WP_057509360.1 ABB28_RS14815 dihydrolipoyllysine-residue succinyltransferase
Query= reanno::pseudo6_N2E2:Pf6N2E2_479 (423 letters) >NCBI__GCF_001431535.1:WP_057509360.1 Length = 401 Score = 227 bits (579), Expect = 4e-64 Identities = 141/417 (33%), Positives = 221/417 (52%), Gaps = 26/417 (6%) Query: 6 IKMPDIGEGIAEVELSVWHVKVGDMVVEDQVLADVMTDKAMVDIPSPVHGRVIALGGEPG 65 +K+P + E +++ ++ WH KVGD V D+ L D+ TDK ++++PS V G + + + G Sbjct: 5 VKVPVLPESVSDGTIATWHKKVGDAVKRDENLVDLETDKVVLEVPSTVDGVLKEIKFQEG 64 Query: 66 EVMAVGSELIRIEVEGAGNLKESAQQAPTPTPAAQAPKPAPVATPEPVLEKTAAPRCAPQ 125 + + L IE EGA +A P PAA+ K E K AAP A Sbjct: 65 DTVTSAQVLAIIE-EGA------VAEAAAPAPAAEEKKA------EAAPAKAAAPAAAAP 111 Query: 126 APVARDP-DERPLASPAVRKHALDLGIQLRLVQGSGPAGRVLHEDLEAYLAQGPSVQAKG 184 AP ++ D P P R A+ G+ V G+G G V ED+ Y G + +A G Sbjct: 112 APASKSAADSLP---PGARFSAITEGVNPADVDGTGRRGAVTKEDIVNYARNGGAGKAGG 168 Query: 185 GSGYAERHDEQQIPVIGMRRKIAQRMQEATQRAAHFSYVEEIDITALEELRVHLNEKHGA 244 E+++P+ MR++IA R+ E+ A + E+++ + R L E+ Sbjct: 169 A------RPEERVPMTRMRKRIADRLMESKNSTAMLTTFNEVNLAKVSAARKELQEEFQK 222 Query: 245 SRG-KLTLLPFLVRALVVALRDFPQMNARYDDEAQVIHRSGAVHVGVATQSDVGLMVPVV 303 + G KL + F V+A AL+ FP +NA D + H G + +A +D GL+ PV+ Sbjct: 223 AHGIKLGFMSFFVKAAANALQRFPLVNASIDGNDVIYH--GYSDISIAVSTDKGLVTPVL 280 Query: 304 RHAEARSLWDNAAEISRLATAARTGKASRDELSGSTITLTSLGALGGIVSTPVLNLPEVA 363 R+ E +S D I+ A AR GK S ++L G T T+T+ G G ++STP++N P+ A Sbjct: 281 RNVERQSFADIEKGIADYAKKARDGKLSLEDLQGGTFTVTNGGTFGSLLSTPIINPPQSA 340 Query: 364 IVGVNKIVERPVVIKGQIVIRKMMNLSSSFDHRVVDGMDAAQFIQALRGLLEQPATL 420 I+G++ I ERP+ GQ+VI MM L+ S+DHR++DG D+ QF+ ++ LE P + Sbjct: 341 ILGMHAIKERPIAENGQVVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRM 397 Lambda K H 0.317 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 401 Length adjustment: 31 Effective length of query: 392 Effective length of database: 370 Effective search space: 145040 Effective search space used: 145040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory