Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate WP_057507779.1 ABB28_RS05820 enoyl-CoA hydratase-related protein
Query= curated2:Q52995 (257 letters) >NCBI__GCF_001431535.1:WP_057507779.1 Length = 259 Score = 193 bits (490), Expect = 3e-54 Identities = 115/255 (45%), Positives = 154/255 (60%), Gaps = 3/255 (1%) Query: 6 LLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGS-EKAFAAG 64 ++V G + +T+ RP+ LNALN +R L AA + D AV ++L G+ KAF AG Sbjct: 5 VVVLDHGFIRTVTVQRPEKLNALNGETLRALAAAFEQAAQDPAVRVVILTGAGPKAFVAG 64 Query: 65 ADIKEMQGLDFVDGYLADFLGG--WEHVANARKPMIAAVSGFALGGGCELAMMCDFIIAS 122 ADI EM L V+G LG + KP+IA V+GFALGGG ELAM C IA Sbjct: 65 ADISEMNTLSAVEGRDFSLLGQRLMRQIERMPKPVIARVNGFALGGGLELAMACHLRIAV 124 Query: 123 ETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVVAP 182 +TA+ GQPEITLG+IPG GGSQRL R G+A A++L L G +DAA A + GLV+ V + Sbjct: 125 DTARLGQPEITLGLIPGFGGSQRLLRLCGRAAALELCLLGTPIDAARALQLGLVNEVASA 184 Query: 183 DRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQKEG 242 D L G AE++A+ + A +AV+ E +L GL +E F LFAT D +EG Sbjct: 185 DDLDARVAGLAERLANAAPLAVRALLDAVHVGGECSLESGLEYESAQFGLLFATHDMREG 244 Query: 243 MAAFVAKRKAEFKHR 257 +AF+ +R A F++R Sbjct: 245 TSAFLERRAAMFQNR 259 Lambda K H 0.321 0.134 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 259 Length adjustment: 24 Effective length of query: 233 Effective length of database: 235 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory